SSBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SSBP1 Polyclonal antibody (12212-1-AP)

• Featured Product
• KD/KO Validated

SSBP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12212-1-AP Copied!

Publications (33)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Mt SSB, MtSSB, Mt-SSB, PWP1 interacting protein 17, PWP1-interacting protein 17

• 

  WB analysis of A549 using 12212-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12212-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 12212-1-AP

  WB result of SSBP1 antibody (12212-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SSBP1 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat pancreas using 12212-1-AP

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 12212-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 12212-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A375 using 12212-1-AP

  IP result of anti-SSBP1 (IP:12212-1-AP, 4ug; Detection:12212-1-AP 1:4000) with A375 cells lysate 1440 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 12212-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12212-1-AP (SSBP1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 12212-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12212-1-AP (SSBP1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 12212-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using 12212-1-AP (SSBP1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SSBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse pancreas tissue, A375 cells, rat pancreas tissue, Caco-2 cells
• Positive IP detected in: A375 cells
• Positive IHC detected in: human stomach cancer tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12212-1-AP targets SSBP1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2860

  Product name: Recombinant human SSBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC000895

  Sequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE

• Full Name: single-stranded DNA binding protein 1
• Calculated Molecular Weight: 148 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC000895
• Gene Symbol: SSBP1
• Gene ID (NCBI): 6742
• RRID: AB_2195320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04837
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SSBP1 is a housekeeping gene involved in mitochondrial biogenesis. it binds preferentially and cooperatively to ss-DNA in the maintainance of genome stability. SSBP1 acted as a homotetramer to stabilize the displaced single strand of the normal and expanded displacement loop (D loop) during mtDNA replication, thus preventing formation of secondary single-stranded DNA structures, which could stop the gamma-DNA polymerase

Publications

What published studies show

SSBP1 antibody (Cat# 12212-1-AP) has accumulated 33 citations across journals including Nature, Science, Cell, Nature Cell Biology, Molecular Cell, Nucleic Acids Research, PNAS, Brain, and Journal of Neuroscience. Associated research fields encompass mitochondrial biology (mtDNA replication, fusion, proteostasis), neurodegeneration (ALS), oncology (lung, ovarian, liver, osteosarcoma), metabolic disease (obesity), inflammation, and inherited genetic disorders (hearing loss, Pearson syndrome). Primary applications are Western blot, immunofluorescence, and IHC.

Automatically generated from the 33 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nature; Stress response silencing by an E3 ligase mutated in neurodegeneration; Authors - Diane L Haakonsen
human,mouse	WB	Science; Nucleotide metabolic rewiring enables NLRP3 inflammasome hyperactivation in obesity.; Authors - Danhui Liu
human	WB	Cell; MTFP1 controls mitochondrial fusion to regulate inner membrane quality control and maintain mtDNA levels; Authors - Luis Carlos Tábara
human	WB	Cell; MOF Acetyl Transferase Regulates Transcription and Respiration in Mitochondria.; Authors - Aindrila Chatterjee
human	WB	Cell; Systematic identification of anticancer drug targets reveals a nucleus-to-mitochondria ROS-sensing pathway; Authors - Junbing Zhang ; KD Validated
human	IF	Nat Cell Biol; Mitochondrial DNA replication stress triggers a pro-inflammatory endosomal pathway of nucleoid disposal; Authors - Laura E Newman