SSBP1 Polyclonal antibody

• 

  WB analysis of A549 using 12212-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis using 12212-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 12212-1-AP

  WB result of SSBP1 antibody (12212-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SSBP1 transfected A549 cells.

• 

  WB analysis of A375 using 12212-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 12212-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat pancreas using 12212-1-AP

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 12212-1-AP (SSBP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A375 using 12212-1-AP

  IP result of anti-SSBP1 (IP:12212-1-AP, 4ug; Detection:12212-1-AP 1:4000) with A375 cells lysate 1440 ug.

• 

  IHC staining of human stomach cancer using 12212-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12212-1-AP (SSBP1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 12212-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12212-1-AP (SSBP1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A375 using 12212-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using 12212-1-AP (SSBP1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SSBP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12212-1-AP

Publications(29)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Mt SSB, MtSSB, Mt-SSB, PWP1 interacting protein 17, PWP1-interacting protein 17

---

Tested Applications

• Positive WB detected in: A549 cells, mouse pancreas tissue, A375 cells, rat pancreas tissue, Caco-2 cells
• Positive IP detected in: A375 cells
• Positive IHC detected in: human stomach cancer tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 25 publications below
• IHC: See 3 publications below
• IF: See 4 publications below
• ChIP: See 1 publications below

Product Information

12212-1-AP targets SSBP1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2860

  Product name: Recombinant human SSBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC000895

  Sequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE

• Full Name: single-stranded DNA binding protein 1
• Calculated Molecular Weight: 148 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC000895
• Gene Symbol: SSBP1
• Gene ID (NCBI): 6742
• RRID: AB_2195320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04837
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SSBP1 is a housekeeping gene involved in mitochondrial biogenesis. it binds preferentially and cooperatively to ss-DNA in the maintainance of genome stability. SSBP1 acted as a homotetramer to stabilize the displaced single strand of the normal and expanded displacement loop (D loop) during mtDNA replication, thus preventing formation of secondary single-stranded DNA structures, which could stop the gamma-DNA polymerase

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nature; Stress response silencing by an E3 ligase mutated in neurodegeneration; Authors - Diane L Haakonsen
human	WB	Cell; MOF Acetyl Transferase Regulates Transcription and Respiration in Mitochondria.; Authors - Aindrila Chatterjee
human	WB	Nat Cell Biol; Mitochondrial RNA granules are fluid condensates positioned by membrane dynamics.; Authors - Timo Rey
human	WB	Mol Cell; Single-Molecule Analysis of mtDNA Replication Uncovers the Basis of the Common Deletion.; Authors - Aaron F Phillips
		Sci Adv; The mitochondrial single-stranded DNA binding protein is essential for initiation of mtDNA replication.; Authors - Min Jiang ; KO Validated
human	IHC	Nucleic Acids Res; Top3α is the replicative topoisomerase in mitochondrial DNA replication.; Authors - Anu Hangas