• Featured Product
  • KD/KO Validated

STAT1 Monoclonal antibody

STAT1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66545-1-Ig
Clone No.1F7C6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

1F7C6, ISGF 3, Signal transducer and activator of transcription 1-alpha/beta, STAT91, Transcription factor ISGF-3 components p91/p84

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HEK-293 cells, NIH/3T3 cells, HeLa cells, MCF-7 cells, Jurkat cells, HSC-T6 cells
Positive IHC detected inhuman ovary tumor tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inIFN alpha treated HeLa cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66545-1-Ig targets STAT1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0199

Product name: Recombinant human STAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-230 aa of BC002704

Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA

Predict reactive species
Full Name signal transducer and activator of transcription 1, 91kDa
Calculated Molecular Weight 83 kDa
Observed Molecular Weight 84 kDa
GenBank Accession NumberBC002704
Gene Symbol STAT1
Gene ID (NCBI) 6772
RRIDAB_2881907
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42224
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?

The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).

 What is the subcellular localization of STAT1?

STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).

 What is the tissue expression pattern of STAT1?

STAT1 is ubiquitously expressed.


Protocols

Product Specific Protocols
IF protocol for STAT1 antibody 66545-1-IgDownload protocol
IHC protocol for STAT1 antibody 66545-1-IgDownload protocol
WB protocol for STAT1 antibody 66545-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

ACS Nano

Dual Inhibition of Endoplasmic Reticulum Stress and Oxidation Stress Manipulates the Polarization of Macrophages under Hypoxia to Sensitize Immunotherapy.

Authors - Mengshi Jiang
pigWB

Int J Biol Macromol

The effect and mechanism of sanguinarine against PCV2 based on the analysis of network pharmacology and TMT quantitative proteomics

Authors - Sihuan Zhang
humanWB

PLoS Pathog

TRIM32 inhibits Venezuelan equine encephalitis virus infection by targeting a late step in viral entry

Authors - Yifan Xie
humanWB,IP,IHC,IF

Commun Biol

STAT1 mediates the pro-inflammatory role of GBP5 in colitis

Authors - Yichen Li
humanWB,IF

Int Immunopharmacol

Silencing SIRT1 promotes the anti-HBV action of IFN-α by regulating Pol expression and activating the JAK-STAT signaling pathway

Authors - Qinyan Tang
ratWB

J Ethnopharmacol

4D-DIA-based Proteomics Analysis Reveals the Protective Effects of Pidanjiangtang Granules in IGT Rat Model

Authors - Yu Xie
Loading...
||
New chat

Able

正在加载,请稍候...