STK39 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• STK39 Polyclonal antibody (31064-1-AP)

• 

  WB analysis using 31064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31064-1-AP (STK39 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

STK39 Polyclonal Antibody for WB, ELISA

Cat No. 31064-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DCHT, PASK, SPAK, Ste 20 related kinase

---

Tested Applications

• Positive WB detected in: Jurkat cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31064-1-AP targets STK39 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34503

  Product name: Recombinant human STK39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-455 aa of BC166614

  Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV

• Full Name: serine threonine kinase 39 (STE20/SPS1 homolog, yeast)
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 60, 68 kDa
• GenBank Accession Number: BC166614
• Gene Symbol: STK39
• Gene ID (NCBI): 27347
• RRID: AB_3742393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UEW8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).