Synaptotagmin-1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Synaptotagmin-1 Polyclonal antibody (14511-1-AP)

• Featured Product
• KD/KO Validated

Synaptotagmin-1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14511-1-AP Copied!

Publications (34)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Synaptotagmin 1, SYT1, P65, SVP65, synaptotagmin I

• 

  WB analysis of HCT 116 using 14511-1-AP

  HCT 116 (WT and SYT1 KO) lysates prepared with RIPA buffer, 50 μg protein loaded. 14511-1-AP incubated at 1:500 at 4°C overnight in 5% BSA in TBST. Ponceau stained transfers shown on right. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  WB analysis using 14511-1-AP

  mouse cerebellum tissue was subjected to SDS PAGE followed by western blot with 14511-1-AP (Synaptotagmin-1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 14511-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14511-1-AP (Synaptotagmin-1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 14511-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 14511-1-AP (Synaptotagmin-1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 14511-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14511-1-AP (Synaptotagmin-1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HCT 116 using 14511-1-AP

  HCT 116 lysates prepared and IP of SYT1 performed using 1.0 μg of 14511-1-AP coupled to protein A- Sepharose beads. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IP experiment of mouse cerebellum using 14511-1-AP

  IP result of anti-Synaptotagmin-1 (IP:14511-1-AP, 4ug; Detection:14511-1-AP 1:20000) with mouse cerebellum tissue lysate 2000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 14511-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 14511-1-AP (Synaptotagmin-1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14511-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 14511-1-AP (Synaptotagmin-1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HCT 116 using 14511-1-AP

  HCT 116 WT cells (yellow outline) and SYT1 KO cells (red outline) labelled with a green or a far red fluorescence dye, respectively. Cells fixed with 4% PFA and stained with 14511-1-AP at 1:500 plus DAPI. Bars = 10 μm. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

Able AI

What's the best dilution for Synaptotagmin-1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, HCT 116 cells, mouse testis tissue, human liver tissue, Y79 cells
• Positive IP detected in: mouse cerebellum tissue, HCT 116 cells
• Positive IHC detected in: rat small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:4000-1:20000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14511-1-AP targets Synaptotagmin-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5970

  Product name: Recombinant human SYT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-422 aa of BC058917

  Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

• Full Name: synaptotagmin I
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 65 kDa, 47 kDa
• GenBank Accession Number: BC058917
• Gene Symbol: Synaptotagmin-1
• Gene ID (NCBI): 6857
• RRID: AB_2199166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21579
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1.

Publications

What published studies show

The Synaptotagmin-1 antibody (Cat# 14511-1-AP) has 34 citations across journals including Nature Communications, Science Advances, Theranostics, Alzheimer's & Dementia, Molecular Psychiatry, Cell Reports, and Acta Neuropathologica. Research fields span neuroscience (synaptic plasticity, neurodegeneration, cognition), oncology (colorectal, prostate, laryngeal cancer), neurology (Alzheimer's, Huntington's, stroke, epilepsy), toxicology, proteomics, and immunology.

Automatically generated from the 34 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Nat Commun; Molecular landscape, subtypes, and therapeutic vulnerabilities of central nervous system solitary fibrous tumors; Authors - Chenhui Zhao
mouse	WB	Nat Commun; Membrane remodeling by FAM92A1 during brain development regulates neuronal morphology, synaptic function, and cognition; Authors - Liang Wang
		Nat Commun; Major urinary protein 1 modulates neuronal excitability in the medial prefrontal cortex in a male mouse model of affective empathy.; Authors - Kun Zhang
human	WB	Theranostics; ANKRD22, a novel tumor microenvironment-induced mitochondrial protein promotes metabolic reprogramming of colorectal cancer cells.; Authors - Tianhui Pan
mouse	WB	Sci Adv; PPT1 selectively depalmitoylates GAP43 to regulate neuronal excitability and cognitive function.; Authors - Jia Tong
mouse	WB	Sci Adv; Phosphorylation of Doc2 by EphB2 modulates Munc13-mediated SNARE complex assembly and neurotransmitter release; Authors - Hong Zhang