ChromoTek Strep VHH, recombinant binding protein

Validation Data Gallery

• 

  Structure of SAWSHPQFEK epitope (also know as Strep-Tag®)

Alpaca anti-Strep-Tag VHH, purified recombinant binding protein

Cat No. qt

Specificity

Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)

Applications

Conjugation

Type

Nanobody

Conjugate

Unconjugated

Synonyms

Strep Tag Nanobody, anti-SAWSHPQFEK VHH

---

Product Information

Alpaca anti-Strep-Tag VHH, purified recombinant binding protein

• Applications: Suitable for conjugation to beads, plates, and surfaces via NHS-chemistry
• Specificity/Target: Binds specifically to the peptide sequence SAWSHPQFEK, also known as ; Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this VHH binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as ; Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position.
• Conjugate: Unconjugated
• Type: Nanobody
• Class: Recombinant
• Host: Alpaca
• Affinity (KD): 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag®
• Molecular Weight: 15 kDa
• RRID: AB_3107052
• Storage Buffer: 25 mM TAPS pH 8.5, 500 mM NaCl, 5 mM EDTA, preservative: 0.09% sodium azide
• Storage Condition: Shipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. Do not freeze!
• Size: 250 µg

---