Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TAF15 Polyclonal antibody

TAF15 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24235-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, RIP, ELISA

TAF(II)68, RNA-binding protein 56, RNA binding protein 56, RBP56, hTAFII68

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IHC detected inhuman cervical cancer tissue, human kidney tissue, human malignant melanoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24235-1-AP targets TAF15 in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20828

Product name: Recombinant human TAF15 protein

Source: e coli.-derived, PET32a

Tag: 6*His

Domain: 244-592 aa of BC046099

Sequence: GVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Predict reactive species
Full Name TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Calculated Molecular Weight 592 aa, 62 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC046099
Gene Symbol TAF15
Gene ID (NCBI) 8148
RRIDAB_2879462
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ92804
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAF15 (TAF2N or TAFII68) is a nuclear protein known to associate with a distinct subpopulation of transcription factor IID (TFIID), a multi-subunit complex that nucleates the pre-initiation complex on promoters of on protein-coding genes. TAF15 harbors a transcriptional activation domain, a RNA recognition motif and many Arg-Gly-Gly repeats that participate in RNA binding. TAF15 along with FUS and EWS constitutes the FET (FUS/EWS/TAF15) protein family of heterogeneous nuclear ribonucleoproteins (hnRNPs) class of RNA binding proteins that are multifunctional proteins implicated in numerous aspects of RNA processing/functions. TAF15 is a nuclear protein that shuttle between cytoplasm-nucleus and as RNA/ssDNA-binding protein, it play specific roles during transcription initiation at distinct promoters and enter the preinitiation complex together with the RNA polymerase II. TAF15 as well as other FET member genes are frequently translocated in sarcomas and rare hematopoietic as well as epithelial cancers. Moreover, dominant mutations in genes coding for four hnRNPs (TDP-43, FUS/TLS, TAF15, and EWS) are found in familial and sporadic cases of ALS and a chromosomal aberration involving TAF15/TAF2N is found in a form of extraskeletal myxoid chondrosarcomas (EMC).

Protocols

Product Specific Protocols
IF protocol for TAF15 antibody 24235-1-APDownload protocol
IHC protocol for TAF15 antibody 24235-1-APDownload protocol
WB protocol for TAF15 antibody 24235-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,RIP

Front Oncol

Long Non-Coding RNA CCAT2 Activates RAB14 and Acts as an Oncogene in Colorectal Cancer.

Authors - Dalu Wang
human,mouseWB,IHC

Mol Cell Biochem

RNF144A-AS1 stabilizes TAF15 and promotes malignant biological behaviors of skin cutaneous melanoma

Authors - Shude Yang
  • KD Validated
humanRIP

Nat Commun

A splicing isoform of PD-1 promotes tumor progression as a potential immune checkpoint

Authors - Xuetong Wang
humanWB,IHC

Cell Mol Biol Lett

The cancer-testis lncRNA LINC01940 promotes gastric cancer malignant progression and chemoresistance by enhancing ribosome biogenesis via TAF15-mediated NOL11 SUMOylation.

Authors - Weijie Zang
humanIF

Stem Cell Res Ther

The circ_0042103/TAF15/NER axis regulates inflammation and DNA damage in pulpitis.

Authors - Feng Lai
Loading...
||
New chat

Able

正在加载,请稍候...