TAP1 Polyclonal antibody

• 

  WB analysis using 11114-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11114-1-AP (TAP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11114-1-AP

  WB result of TAP1 antibody (11114-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TAP1 transfected HeLa cells.

• 

  WB analysis using 11114-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11114-1-AP (TAP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 11114-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11114-1-AP (TAP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 11114-1-AP

  IP result of anti-TAP1 (IP:11114-1-AP, 4ug; Detection:11114-1-AP 1:3000) with HepG2 cells lysate 1320 ug.

• 

  IHC staining of human pancreas cancer using 11114-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11114-1-AP (TAP1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 11114-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11114-1-AP (TAP1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 11114-1-AP

  Immunofluorescent analysis of HepG2 cells, using TAP1 antibody 11114-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• 

  IF Staining of HepG2 using 11114-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 11114-1-AP (TAP1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TAP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11114-1-AP

Publications(32)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

RING4, PSF-1, PSF1, EC:7.4.2.14, ATP-binding cassette sub-family B member 2

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HepG2 cells, mouse skeletal muscle tissue, HeLa cells, mouse spleen tissue, SW480 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 18 publications below
• IHC: See 13 publications below
• IF: See 7 publications below
• IP: See 2 publications below
• RIP: See 1 publications below

Product Information

11114-1-AP targets TAP1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1619

  Product name: Recombinant human TAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 509-808 aa of BC014081

  Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

• Full Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70-81 kDa
• GenBank Accession Number: BC014081
• Gene Symbol: TAP1
• Gene ID (NCBI): 6890
• RRID: AB_2200201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03518
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Gastroenterology; microRNA 125a Regulates MHC-I Expression on Esophageal Adenocarcinoma Cells, Associated With Suppression of Antitumor Immune Response and Poor Outcomes of Patients.; Authors - Luigi Mari
human	IHC	Nat Commun; Proteomic analysis of archival breast cancer clinical specimens identifies biological subtypes with distinct survival outcomes.; Authors - Karama Asleh
human	WB,IP	Proc Natl Acad Sci U S A; The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation; Authors - Magda Wąchalska
mouse	WB	Theranostics; Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells.; Authors - Jingyao Tu
human,mouse	WB	Int J Cancer; Antitumor efficacy of intermittent low-dose erlotinib plus sulindac via MHC upregulation and remodeling of the immune cell niche; Authors - Chakrapani Tripathi
human	IHC	Int J Mol Sci; Antigen Peptide Transporter 1 (TAP1) Promotes Resistance to MEK Inhibitors in Pancreatic Cancers.; Authors - Boya Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Adrianna (Verified Customer) (10-24-2022)

This antibody is excellent. I've tried anti TAP1 antibodies from different companies and they all showed brighter bands for contaminants than the TAP1 protein, here I can clearly see my protein of interest.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: MCF7