TDG Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TDG Polyclonal antibody (13370-1-AP)

• Featured Product
• KD/KO Validated

TDG Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 13370-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

EC:3.2.2.29, G/T mismatch-specific thymine DNA glycosylase, hTDG, thymine DNA glycosylase, Thymine-DNA glycosylase

• 

  WB analysis using 13370-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 13370-1-AP

  WB result of TDG antibody (13370-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TDG transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13370-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 13370-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 13370-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 13370-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13370-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of U-937 using 13370-1-AP

  IP result of anti-TDG (IP:13370-1-AP, 3ug; Detection:13370-1-AP 1:400) with U-937 cells lysate 3000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13370-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 13370-1-AP (TDG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TDG in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HEK-293 cells, HeLa cells, human brain tissue, mouse colon tissue, mouse thymus tissue, Raji cells, HCT-116 cells, Jurkat cells, K-562 cells, MCF-7 cells
• Positive IP detected in: U-937 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13370-1-AP targets TDG in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4190

  Product name: Recombinant human TDG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-410 aa of BC037557

  Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

• Full Name: thymine-DNA glycosylase
• Calculated Molecular Weight: 410 aa, 46 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC037557
• Gene Symbol: TDG
• Gene ID (NCBI): 6996
• RRID: AB_2271704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13569
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa.

Publications

What published studies show

The Anti-TDG antibody (Cat# 13370-1-AP) has 13 total citations. These appear in 11 journals including Nature, Nat Chem Biol, PNAS, Cell Death & Disease, Cell Death Discovery, Int J Biol Sci, J Cell Biol, J Biol Chem, Cancer Sci, Cell Mol Biol Lett, and bioRxiv. Research fields span DNA damage repair, active DNA demethylation, base excision repair, Wnt signaling, oxidative stress, R-loop biology, and multiple cancer types (thyroid, colon, glioma, hepatocellular, colorectal). Applications include WB, IHC, IP, and ChIP.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Human HDAC6 senses valine abundancy to regulate DNA damage; Authors - Jiali Jin
mouse	IHC	Nat Chem Biol; Targeting thymine DNA glycosylase induces synthetic lethality in p53-deficient cancers.; Authors - Jia-Xin Zhou
human	WB	Cell Death Dis; The HOTAIRM1/miR-107/TDG axis regulates papillary thyroid cancer cell proliferation and invasion.; Authors - Dan Li
human	WB	Cell Mol Biol Lett; Hypoxia-induced genome-wide DNA demethylation by DNMT3A and EMT of cancer cells; Authors - Biswanath Chatterjee
human	WB	Int J Biol Sci; TDG suppresses the migration and invasion of human colon cancer cells via the DNMT3A/TIMP2 axis.; Authors - Jiyu Miao
human	IHC,ChIP	Cell Death Discov; TNC upregulation promotes glioma tumourigenesis through TDG-mediated active DNA demethylation; Authors - Hongyu Xu ; KO Validated