THAP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• THAP1 Polyclonal antibody (12584-1-AP)

• Featured Product
• KD/KO Validated

THAP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12584-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ChIP, ELISA

Synonyms

THAP1

• 

  WB analysis of HepG2 using 12584-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 12584-1-AP

  WB result of THAP1 antibody (12584-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-THAP1 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 12584-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12584-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12584-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12584-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 12584-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 12584-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12584-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 12584-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SGC-7901 using 12584-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12584-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12584-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12584-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12584-1-AP (THAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12584-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 12584-1-AP (THAP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for THAP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, human brain tissue, HEK-293 cells, HeLa cells, human heart tissue, A375 cells, SGC-7901 cells, mouse brain tissue, mouse heart tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12584-1-AP targets THAP1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3285

  Product name: Recombinant human THAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC021721

  Sequence: MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA

• Full Name: THAP domain containing, apoptosis associated protein 1
• Calculated Molecular Weight: 213 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC021721
• Gene Symbol: THAP1
• Gene ID (NCBI): 55145
• RRID: AB_2201672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVV9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

THAP1 belongs to the THAP1 family. It is a DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. THAP1 may also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis. Mutations in THAP1 have been associated with dystonia 6. THAP1 encodes a transcription factor with mostly unknown targets. It regulates the expression of DYT1 (TOR1A), another dystonia-causing gene. After characterization of the TOR1A promoter, THAP1 binds to the core promoter of TOR1A. Wild type THAP1 represses the expression of TOR1A, whereas dystonia 6-associated mutant THAP1 results in decreased repression of TOR1A. Catalog#12584-1-AP is a rabbit polyclonal antibody raised against full-length of huamn THAP1.

Publications

What published studies show

The anti-THAP1 antibody (Cat# 12584-1-AP) has 13 total citations. These appear in journals including Nature Genetics, Nature Communications, Molecular Cell, Nucleic Acids Research, Brain, Developmental Cell, Annals of Neurology, Acta Neuropathologica Communications, Neuroscience, Human Molecular Genetics, and Journal of Molecular Neuroscience. Research fields span DYT6 dystonia genetics, THAP1 transcriptional regulation, proteasome function, DNA double-strand break repair, myelination, and cerebellar motor function in human and mouse models.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Genet; Mutations in the histone methyltransferase gene KMT2B cause complex early-onset dystonia.; Authors - Esther Meyer
human	WB	Nat Commun; The DYT6 dystonia causative protein THAP1 is responsible for proteasome activity via PSMB5 transcriptional regulation; Authors - Yan Wang
human	WB	Nat Commun; Loss-of-function mutations in the dystonia gene THAP1 impair proteasome function by inhibiting PSMB5 expression; Authors - Dylan E Ramage
mouse	WB,ChIP	Mol Cell; The dystonia gene THAP1 controls DNA double-strand break repair choice.; Authors - Kenta Shinoda ; KO Validated
human	WB	Nucleic Acids Res; Stress-induced changes in gene interactions in human cells.; Authors - Nayak Renuka R RR
human	WB	Brain; DYT6 mutated THAP1 is a cell type dependent regulator of the SP1 family.; Authors - Fubo Cheng ; KO Validated