Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11973-1-AP targets TIMM13 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2596 Product name: Recombinant human TIMM13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC008607 Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 13 homolog (yeast) |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC008607 |
| Gene Symbol | TIMM13 |
| Gene ID (NCBI) | 26517 |
| RRID | AB_2287228 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5L4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIMM13 gene, also known as TIM13, TIM13B, TIM M13A or TIMM13B, encodes mitochondrial import inner membrane translocase subunit Tim13 belonging to the small Tim family. TIM13 functions as mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Proteins of the intermembrane space (IMS) of mitochondria are typically synthesized without presequences. TIM13 contains four conserved cysteine residues that bind a zinc ion as cofactor. Import of TIM13 did not depend on the membrane potential or ATP hydrolysis. Upon import into mitochondria TIM13 adopted a stably folded conformation in the IMS.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMM13 antibody 11973-1-AP | Download protocol |
| IHC protocol for TIMM13 antibody 11973-1-AP | Download protocol |
| WB protocol for TIMM13 antibody 11973-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TIMM13 Polyclonal antibody (Cat# 11973-1-AP) has 12 citations across journals including Cell Stem Cell, Science Advances, Cell Death & Differentiation, American Journal of Human Genetics, EMBO Reports, Oncology Research, Frontiers in Oncology, FEBS Letters, Molecular Genetics and Metabolism Reports, Molecular Genetics and Genomic Medicine, eLife, and Advanced Science. Research fields encompass mitochondrial biology (protein import, Complex IV assembly, respiration), cancer (leukemic stem cells, lung and colorectal cancer), and inherited mitochondrial/genetic disorders.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. | ||
Sci Adv Hypoxia-responsive interaction between P-TEFb, BHLHE40, and Tim8-Tim13 regulates hypoxic gene transcription. | ||
Cell Death Differ Targeting prohibitins activates the ISR through DELE1-HRI by impairing protein import into the mitochondrial matrix. | ||
Am J Hum Genet The mitochondrial disulfide relay system protein GFER is mutated in autosomal-recessive myopathy with cataract and combined respiratory-chain deficiency. | ||
EMBO Rep Human Tim8a, Tim8b and Tim13 are auxiliary assembly factors of mature Complex IV | ||
Reviews
What customers say
The single review reports a 5-star rating for this antibody used in immunofluorescence on HeLa FlipIn cells to label mitochondria. The user applied a 1:100 dilution, fixed cells with 4% paraformaldehyde in PBS for 10 minutes at room temperature, permeabilized with 0.1% Triton X, incubated the primary antibody overnight at 4°C, and used a 1:700 Alexa Fluor 488 secondary antibody for 1 hour at room temperature. The protocol produced satisfactory results, and the reviewer was fully satisfied with the product's performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Süleyman (Verified Customer) (01-22-2022) | I tested for IMS labelling of mitochondria. I used 1:700 Alexa Fluor 488 secondary antibody. Fixed 4% paraformaldehyde in PBS for 10 minutes at RT and 0.1% Triton X permeabilization. Overnight primary ab labelling at 4 oC. 1 hour secondary ab labelling at RT.
 |
