Tested Applications
| Positive WB detected in | HL-60 cells, HT-29 cells, HeLa cells, SKOV-3 cells |
| Positive IF/ICC detected in | HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16644-1-AP targets TIMP1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10006 Product name: Recombinant human TIMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC000866 Sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Predict reactive species |
| Full Name | TIMP metallopeptidase inhibitor 1 |
| Calculated Molecular Weight | 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC000866 |
| Gene Symbol | TIMP1 |
| Gene ID (NCBI) | 7076 |
| RRID | AB_2878292 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01033 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMP1 antibody 16644-1-AP | Download protocol |
| WB protocol for TIMP1 antibody 16644-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Rabbit Monoclonal Antibody to TIMP1 (Cat# 16644-1-AP) has accumulated 133 citations published in journals including Nature Neuroscience, Nature Communications, Science Advances, PNAS, Oncogene, Cell Death & Disease, ACS Nano, and Phytomedicine. Associated research fields encompass fibrosis (hepatic, pulmonary, renal, cardiac), oncology (colorectal, hepatocellular, breast, lung, glioma), neuroscience (stroke, spinal cord injury, Alzheimer's disease), ferroptosis, extracellular matrix remodeling, inflammation, and tissue repair/regeneration.
| Species | Application | Title |
|---|---|---|
Nat Neurosci Derivation and transcriptional reprogramming of border-forming wound repair astrocytes after spinal cord injury or stroke in mice | ||
Mol Neurodegener Amyloid-β (Aβ) immunotherapy induced microhemorrhages are associated with activated perivascular macrophages and peripheral monocyte recruitment in Alzheimer's disease mice | ||
Nat Commun A nanosystem targeting tissue inhibitor of metalloproteinase-1 for continuous spatiotemporal idiopathic pulmonary fibrosis therapy. | ||
ACS Nano Vitamin A-Integrated Cinnamaldehyde Nanoemulsion: A Nanotherapeutic Approach To Counteract Liver Fibrosis via Gut-Liver Axis Modulation | ||
J Adv Res MiR-4521 plays a tumor repressive role in growth and metastasis of hepatocarcinoma cells by suppressing phosphorylation of FAK/AKT pathway via targeting FAM129A. | ||
J Nanobiotechnology Human adipose-derived mesenchymal stem cell-derived exosomes induce epithelial remodeling and anti-scar healing revealed by single-cell RNA sequencing |
