TLE1 Polyclonal antibody

TLE1 Polyclonal Antibody for IHC, ELISA
Cat No. 11284-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

E(Sp1) homolog, ESG, ESG1, GRG1, TLE1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11284-1-AP targets TLE1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1801

Product name: Recombinant human TLE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 422-770 aa of BC010100

Sequence: DPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

Predict reactive species
Full Name transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
Calculated Molecular Weight 83 kDa
GenBank Accession NumberBC010100
Gene Symbol TLE1
Gene ID (NCBI) 7088
RRIDAB_2256022
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ04724
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transducin-like enhancer protein 1(TLE1) is a transcriptional corepressor. It can bind to and regress expression of many transcription factors such as NFkB, which is mediated by FOXA2, CTNNB1 and TCF family member in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Expression of TLE1 is highest in skeletal muscle and liver, moderate in placenta, heart, kidney, and spleen, and weak in all other tissues including brain.

Protocols

Product Specific Protocols
IHC protocol for TLE1 antibody 11284-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Hepatology

MicroRNA-657 promotes tumorigenesis in hepatocellular carcinoma by targeting transducin-like enhancer protein 1 through nuclear factor kappa B pathways.

Authors - Zhang Lisheng L
Loading...
||
New chat Able
正在加载,请稍候...