Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse liver tissue, RAW 264.7 cells, J774A.1 cells |
| Positive IHC detected in | human placenta tissue, mouse brain tissue, human liver cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19811-1-AP targets TLR4 in WB, IHC, IF-Fro, IP, CoIP, ChIP, ELISA, Blocking assay, Microtiter plate binding assay, Western Blot applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, chicken, zebrafish, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13841 Product name: Recombinant human TLR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 653-839 aa of BC117422 Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI Predict reactive species |
| Full Name | toll-like receptor 4 |
| Calculated Molecular Weight | 839 aa, 96 kDa |
| Observed Molecular Weight | 90-110 kDa |
| GenBank Accession Number | BC117422 |
| Gene Symbol | TLR4 |
| Gene ID (NCBI) | 7099 |
| RRID | AB_10638446 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00206 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP, and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described. The calculated molecular weights of the three TLR4 isoforms are 96, 91, and 73 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TLR4 antibody 19811-1-AP | Download protocol |
| IHC protocol for TLR4 antibody 19811-1-AP | Download protocol |
| WB protocol for TLR4 antibody 19811-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TLR4 antibody (Cat# 19811-1-AP) has 915 total citations published in journals such as Nature Communications, Immunity, Advanced Science, J Neuroinflammation, Phytomedicine, Free Radical Biology and Medicine, Frontiers in Immunology, and Biomaterials. Associated research fields include immunology, neuroinflammation, gut microbiota, TLR4/NF-κB signaling, sepsis, cancer, diabetes, liver disease, cardiovascular pathology, and nanomedicine-based therapeutics. Primary applications are WB, IF, IHC, IP, CoIP, and ELISA across human, mouse, rat, and pig species.
| Species | Application | Title |
|---|---|---|
Immunity Alarmin-loaded extracellular lipid droplets induce airway neutrophil infiltration during type 2 inflammation | ||
Immunity Intestinal dysbiosis exacerbates skin inflammation via microbial metabolite-driven Th2 cell differentiation. | ||
Adv Mater Biomimetic Immunosuppressive Exosomes that Inhibit Cytokine Storms Contribute to the Alleviation of Sepsis. | ||
Cell Mol Immunol MARCH2/3 target FcγRI for K27-linked polyubiquitination and degradation to restrict the inflammatory response. | ||
Bioact Mater Novel neutrophil extracellular trap-related mechanisms in diabetic wounds inspire a promising treatment strategy with hypoxia-challenged small extracellular vesicles | ||
Transl Neurodegener SSEA3 and CD105 positivity are associated with the treatment potency of human neural crest-derived nasal turbinate stem cells for Alzheimer's disease. |
Reviews
What customers say
All five reviews rate this TLR4 antibody highly (4–5 stars). Users consistently report sharp, clear bands in Western Blot at a 1:1000 dilution across various cell types, including colon cancer cells and mouse primary B cells. One reviewer confirmed reliable performance in IHC, IF, and IP, noting it eased their project under confocal microscopy. The only 4-star review provided a detailed WB protocol on mouse spleen B cells, detecting two bands around 70 kDa. Overall, customers find the antibody specific, sensitive, and versatile across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (03-23-2026) | TLR4 antibody works very well
|
Iram (Verified Customer) (03-23-2026) | It gives very sharp bands.
|
Mounika (Verified Customer) (01-08-2026) | Excellent bands, Good while observing under confocal microscope, eased out our project
|
Iram (Verified Customer) (12-19-2025) | Works well for IB
|
Sara (Verified Customer) (10-25-2020) | B cells (mouse) were lysated in RIPA buffer with protein and phosphatase inhibitors. 10 µg of protein per lane were loaded in a 10% PAGE-SDS gel. Proteins were transferred to a PVFD membrane (Turbo Blot system) and incubated overnight with 1:1000 of anti-TLR4, followed by anti-rabbit-HRP (1:10.000) on the next day. Two bands of around 70 kDa are detected.
 |
