• Featured Product
  • KD/KO Validated

TNFR1/CD120a Polyclonal antibody

TNFR1/CD120a Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 21574-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

TNFRSF1A, TBP1, p60, p55 R, p55

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, HL-60 cells, human brain tissue, HeLa cells
Positive IHC detected inhuman brain tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21574-1-AP targets TNFR1/CD120a in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16112

Product name: Recombinant human TNFR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 235-455 aa of BC010140

Sequence: RYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 1A
Calculated Molecular Weight 455 aa, 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC010140
Gene Symbol TNFR1
Gene ID (NCBI) 7132
RRIDAB_10734433
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19438
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor (TNF) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNF exists in soluble and membrane-bound forms. TNF signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a) and TNFR2 (TNFRSF1B, CD120b). Whereas TNFR1 is widely expressed, expression of TNFR2 is limited to cells of the immune system, endothelial cells, and nerve cells (PMID: 22053109). TNFR1, which contains a death domain (DD) within its intracytoplasmic region, is thought to be the key receptor for TNF signaling (PMID: 16407280). This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor.

Protocols

Product Specific Protocols
WB protocol for TNFR1/CD120a antibody 21574-1-APDownload protocol
IHC protocol for TNFR1/CD120a antibody 21574-1-APDownload protocol
IF protocol for TNFR1/CD120a antibody 21574-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Cancer Commun (Lond)

Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies

Authors - Lu Tang
WB,IF

Adv Healthc Mater

Hyaluronic Acid-based ROS-responsive Multifunctional Injectable Hydrogel Platform Accelerating Diabetic Wound Healing

Authors - Chen Shi
humanWB

Aging Dis

MiR-29a-3p Improves Acute Lung Injury by Reducing Alveolar Epithelial Cell PANoptosis.

Authors - Yanhui Cui
mouseWB

PLoS Biol

A unique death pathway keeps RIPK1 D325A mutant mice in check at embryonic day 10.5.

Authors - Yingying Zhang
humanWB

Cell Death Discov

Repositioning linifanib as a potent anti-necroptosis agent for sepsis

Authors - Liang Yu
humanWB,IP

Cancer Lett

Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells.

Authors - Bei Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Xinda (Verified Customer) (08-16-2024)

It gave very nice and specific bands.

  • Applications: Cell culture
FH

Tinne (Verified Customer) (08-14-2023)

This AB worked quite well - not the strongest signal - might be worth increasing the concentration. I got the best results when I did not permeabilise the cells.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Human hippocampal progenitor cells
TNFR1/CD120a Antibody Immunofluorescence validation (1:400 dilution) in Human hippocampal progenitor cells (Cat no:21574-1-AP)
Loading...