Tested Applications
| Positive WB detected in | NK-92 cells, Jurkat cells, HEK-293 cells, THP-1 cells, mouse thymus tissue, rat thymus tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19272-1-AP targets TNFR2/CD120b in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5866 Product name: Recombinant human TNFR2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 38-282 aa of BC052977 Sequence: STCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCV Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 1B |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC052977 |
| Gene Symbol | TNFR2 |
| Gene ID (NCBI) | 7133 |
| RRID | AB_10640674 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20333 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tumor necrosis factor-alpha (TNFA/TNFSF2) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNFA signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a, p55) and TNFR2 (TNFRSF1B, CD120b, p75). TNFR1 is widely expressed, whereas TNFR2 exhibits more restricted expression, being found on CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells (PMID: 20489699; 22374304). In contrast to TNFR1, TNFR2 does not have a death domain. TNFR2 only signals for antiapoptotic reactions. However, recent evidence indicates that TNFR2 also signals to induce TRAF2 degradation (PMID: 22374304). Various defects in the TNFR2 pathway, due to polymorphisms in the TNFR2 gene, upregulated expression of TNFR2 and TNFR2 shedding, have been implicated in the pathology of several autoimmune disorders (PMID: 20489699).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNFR2/CD120b antibody 19272-1-AP | Download protocol |
| IHC protocol for TNFR2/CD120b antibody 19272-1-AP | Download protocol |
| IP protocol for TNFR2/CD120b antibody 19272-1-AP | Download protocol |
| WB protocol for TNFR2/CD120b antibody 19272-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TNFR2/CD120b Polyclonal antibody (Cat# 19272-1-AP) has 50 citations. These appear in high-impact journals including Nature, Nature Immunology, Nature Communications, Acta Pharmaceutica Sinica B, Journal of Experimental & Clinical Cancer Research, Biomaterials, Cancer Letters, Molecular Therapy, and journals such as Oncology Letters, Brain, Behavior & Immunity, and Frontiers series. Research fields span oncology (colorectal, esophageal, lung, liver cancers), immunology and inflammation, macrophage biology, neurology, and cardiovascular disease, with applications mainly in WB, IF, IHC, and CoIP.
| Species | Application | Title |
|---|---|---|
Nat Immunol NKILA lncRNA promotes tumor immune evasion by sensitizing T cells to activation-induced cell death. | ||
Nat Commun Targeted therapies of inflammatory diseases with intracellularly gelated macrophages in mice and rats | ||
Nat Commun Engineered Spirulina platensis for treating rheumatoid arthritis and restoring bone homeostasis | ||
Acta Pharm Sin B Choroid plexus CCL2‒CCR2 signaling orchestrates macrophage recruitment and cerebrospinal fluid hypersecretion in hydrocephalus | ||
J Exp Clin Cancer Res KIAA1522 potentiates TNFα-NFκB signaling to antagonize platinum-based chemotherapy in lung adenocarcinoma. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The user performed immunofluorescence (ICC) on human hippocampal progenitor cells using a 1:400 dilution and reported that the antibody "worked really well." Overall, the feedback indicates strong performance and reliability for intracellular staining applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tinne (Verified Customer) (08-14-2023) | This worked really well for ICC of human HPCs.
 |
