• Featured Product
  • KD/KO Validated

TNFR2/CD120b Polyclonal antibody

TNFR2/CD120b Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 19272-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

TNFR2 / TNFRSF1B, TNFRSF1B, CD120b, Etanercept, p75

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNK-92 cells, Jurkat cells, HEK-293 cells, THP-1 cells, mouse thymus tissue, rat thymus tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19272-1-AP targets TNFR2/CD120b in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5866

Product name: Recombinant human TNFR2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 38-282 aa of BC052977

Sequence: STCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCV

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 1B
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC052977
Gene Symbol TNFR2
Gene ID (NCBI) 7133
RRIDAB_10640674
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20333
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor-alpha (TNFA/TNFSF2) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNFA signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a, p55) and TNFR2 (TNFRSF1B, CD120b, p75). TNFR1 is widely expressed, whereas TNFR2 exhibits more restricted expression, being found on CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells (PMID: 20489699; 22374304). In contrast to TNFR1, TNFR2 does not have a death domain. TNFR2 only signals for antiapoptotic reactions. However, recent evidence indicates that TNFR2 also signals to induce TRAF2 degradation (PMID: 22374304). Various defects in the TNFR2 pathway, due to polymorphisms in the TNFR2 gene, upregulated expression of TNFR2 and TNFR2 shedding, have been implicated in the pathology of several autoimmune disorders (PMID: 20489699).

Protocols

Product Specific Protocols
WB protocol for TNFR2/CD120b antibody 19272-1-APDownload protocol
IHC protocol for TNFR2/CD120b antibody 19272-1-APDownload protocol
IF protocol for TNFR2/CD120b antibody 19272-1-APDownload protocol
IP protocol for TNFR2/CD120b antibody 19272-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Immunol

NKILA lncRNA promotes tumor immune evasion by sensitizing T cells to activation-induced cell death.

Authors - Di Huang
humanWB

Mol Ther

Tumor necrosis factor alpha delivers exogenous inflammation-related microRNAs to recipient cells with functional targeting capabilities.

Authors - Yuechao Zhao
ratWB

Mater Today Bio

Intracellular hydrogelation of macrophage conjugated probiotics for hitchhiking delivery and combined treatment of colitis

Authors - Jingzhe Wang
ratWB

Oxid Med Cell Longev

Protective Effects of Cinnamaldehyde against Mesenteric Ischemia-Reperfusion-Induced Lung and Liver Injuries in Rats.

Authors - Marwan Almoiliqy
humanWB

Cancer Lett

Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells.

Authors - Bei Wang
mouseIF

Pain

Nox2-dependent signaling between macrophages and sensory neurons contributes to neuropathic pain hypersensitivity.

Authors - Wiebke Kallenborn-Gerhardt

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tinne (Verified Customer) (08-14-2023)

This worked really well for ICC of human HPCs.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Human hippocampal progenitor cells
TNFR2/CD120b Antibody Immunofluorescence validation (1:400 dilution) in Human hippocampal progenitor cells (Cat no:19272-1-AP)
Loading...