TREM2 Polyclonal antibody

• 

  WB analysis using 27599-1-AP

  Non-treated and PMA treated THP-1 cellls were subjected to SDS PAGE followed by western blot with 27599-1-AP (TREM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TREM2 Polyclonal Antibody for WB, ELISA

Cat No. 27599-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Trem2c, Trem2b, Trem2a, TREM-2, TREM 2

---

Tested Applications

• Positive WB detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 10 publications below
• IHC: See 1 publications below
• IF: See 4 publications below

Product Information

27599-1-AP targets TREM2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26319

  Product name: Recombinant human TREM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 19-161 aa of BC032362

  Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR

• Full Name: triggering receptor expressed on myeloid cells 2
• Calculated Molecular Weight: 222 aa, 25 kDa
• Observed Molecular Weight: 26-32 kDa
• GenBank Accession Number: BC032362
• Gene Symbol: TREM2
• Gene ID (NCBI): 54209
• RRID: AB_2880921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZC2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Dev Cell; HMOX1-LDHB interaction promotes ferroptosis by inducing mitochondrial dysfunction in foamy macrophages during advanced atherosclerosis; Authors - Xiang Peng
human	IF	Cell Death Dis; Heterogeneity of tumor microenvironment is associated with clinical prognosis of non-clear cell renal cell carcinoma: a single-cell genomics study.; Authors - Wen-Jin Chen
human,mouse	WB	Sci Adv; TREM2 inhibition triggers antitumor cell activity of myeloid cells in glioblastoma; Authors - Rui Sun
human	IF	Front Immunol; Identification of TREM2-positive tumor-associated macrophages in esophageal squamous cell carcinoma: implication for poor prognosis and immunotherapy modulation; Authors - Hongmu Li
human,mouse	WB,IHC,IF	Nat Commun; Soluble TREM2 ameliorates tau phosphorylation and cognitive deficits through activating transgelin-2 in Alzheimer's disease; Authors - Xingyu Zhang
mouse	WB	Brain Res; TREM2 regulates BV2 microglia activation and influences corticosterone-induced neuroinflammation in depressive disorders; Authors - Jingjing Shi