TWIST2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TWIST2 Polyclonal antibody (11752-1-AP)

• Featured Product
• KD/KO Validated

TWIST2 Polyclonal Antibody for WB, ELISA

Cat No. 11752-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

bHLHa39, Dermis expressed protein 1, Dermo 1, DERMO1, twist homolog 2 (Drosophila), Twist related protein 2, TWIST2

• 

  WB analysis of NIH/3T3 using 11752-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11752-1-AP (TWIST2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 11752-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11752-1-AP (TWIST2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11752-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11752-1-AP (TWIST2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 11752-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11752-1-AP (TWIST2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TWIST2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, MCF-7 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11752-1-AP targets TWIST2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2348

  Product name: Recombinant human TWIST2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC033168

  Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH

• Full Name: twist homolog 2 (Drosophila)
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 21 kDa, 60 kDa
• GenBank Accession Number: BC033168
• Gene Symbol: TWIST2
• Gene ID (NCBI): 117581
• RRID: AB_2877791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVJ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TWIST2, also named as BHLHA39 and DERMO1,is a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. TWIST2 inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors. It is also implicated in tumorigenesis, invasion and metastasis. TWIST2 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419).

Publications

What published studies show

The TWIST2 Polyclonal antibody (Cat# 11752-1-AP) has 17 citations published in journals including Cell Death Discovery, Stem Cell Research & Therapy, Molecular Cancer Research, Frontiers in Cell and Developmental Biology, Translational Oncology, Neoplasia, Clinical & Experimental Medicine, and others. Research fields span epithelial-mesenchymal transition, Wnt/β-catenin signaling, tumor metastasis, and cancer progression across glioma, gastric, hepatocellular, colorectal, breast, lung, pancreatic, and renal cancers, as well as cartilage regeneration.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,WB	Cell Death Dis; Exosomal miR-155-5p derived from glioma stem-like cells promotes mesenchymal transition via targeting ACOT12; Authors - Zixu Bao
human	WB	Cell Death Discov; Long noncoding RNA CERS6-AS1 modulates glucose metabolism and tumor progression in hepatocellular carcinoma by promoting the MDM2/p53 signaling pathway.; Authors - Bo Xu
human	WB,IF	Stem Cell Res Ther; Blocking calcium-MYC regulatory axis inhibits early dedifferentiation of chondrocytes and contributes to cartilage regeneration; Authors - Xu Wu
human	IHC	Aging (Albany NY); LINC01235-TWIST2 feedback loop facilitates epithelial-mesenchymal transition in gastric cancer by inhibiting THBS2.; Authors - Yu-En Tan
human	WB	Mol Cancer Res; USP10 regulates ZEB1 ubiquitination and protein stability to inhibit ZEB1-mediated colorectal cancer metastasis; Authors - Lei Sun
human	WB	Biol Direct; ELK4 induced upregulation of HOMER3 promotes the proliferation and metastasis in glioma via Wnt/β-catenin/EMT signaling pathway; Authors - Furong Wang