FAT10 Polyclonal antibody

• 

  WB analysis using 13003-2-AP

  TNF alpha and IFN gamma treated HepG2 cells were subjected to SDS PAGE followed by western blot with 13003-2-AP (FAT10 antibody) at dilution of 1:1000 and incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 13003-2-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13003-2-AP (FAT10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 13003-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13003-2-AP (FAT10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 13003-2-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 13003-2-AP (FAT10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 13003-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13003-2-AP (FAT10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FAT10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13003-2-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Diubiquitin, FAT10, GABBR1, UBD, UBD 3, ubiquitin D, Ubiquitin like protein FAT10

---

Tested Applications

• Positive WB detected in: TNF alpha and IFN gamma treated HepG2 cells
• Positive IHC detected in: human tonsillitis tissue, human lung cancer tissue, human lymphoma tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 9 publications below
• IF: See 4 publications below
• CoIP: See 1 publications below

Product Information

13003-2-AP targets FAT10 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3680

  Product name: Recombinant human UBD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC012472

  Sequence: MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG

• Full Name: ubiquitin D
• Calculated Molecular Weight: 165 aa, 18 kDa
• Observed Molecular Weight: 20 kDa, 70kDa
• GenBank Accession Number: BC012472
• Gene Symbol: FAT10
• Gene ID (NCBI): 10537
• RRID: AB_2304122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15205
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAT10, also named UBD, contains two ubiquitin-like domains. It is a ubiquitin-like protein modifier that can be covalently attached to the target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1L-dependent manner. FAT10 also has important roles in cell mitosis, chromosome instability, apoptosis, and immune response. FAT10 mediates apoptosis in a caspase-dependent manner, especially in the renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN). It promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). FAT10 regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. It may be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. FAT10 may be a marker for precancerous lesions and may promote cancer progression. This antibody is a rabbit polyclonal antibody raised against full-length FAT10 of human origin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Cancer Res; The Ubiquitin-like Protein FAT10 Stabilizes eEF1A1 Expression to Promote Tumor Proliferation in a Complex Manner.; Authors - Xiuxia Liu ; KD Validated
mouse	WB,IF	J Biol Chem; Ubiquitin D regulates IRE1α/JNK-dependent apoptosis in pancreatic beta cells.; Authors - Flora Brozzi
human	WB	Environ Toxicol; Increased UBD Is a Potential Diagnostic and Prognostic Biomarker in Glioma; Authors - Tao Wu
mouse	IHC	DNA Res; Identification of novel genes selectively expressed in the follicle-associated epithelium from the meta-analysis of transcriptomics data from multiple mouse cell and tissue populations.; Authors - Kobayashi Atsushi A
rat	IHC	Toxicol Lett; Ochratoxin A induces karyomegaly and cell cycle aberrations in renal tubular cells without relation to induction of oxidative stress responses in rats.; Authors - Taniai Eriko E
human	IHC	Discov Oncol; Transcription factor networks and novel immune biomarkers reveal key prognostic and therapeutic insights in ovarian cancer; Authors - Aiqin Zhao