Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

UHRF1 Polyclonal antibody

UHRF1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

E3 ubiquitin-protein ligase UHRF1, EC:2.3.2.27, hNp95, hUHRF1, HuNp95

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for UHRF1 in ?

Tested Applications

Positive WB detected inHuH-7 cells, HEK-293T cells, HeLa cells, MCF-7 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue, mouse thymus tissue, rat thymus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21402-1-AP targets UHRF1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16111

Product name: Recombinant human UHRF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 88-392 aa of BC113875

Sequence: QSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRE

Predict reactive species
Full Name ubiquitin-like with PHD and ring finger domains 1
Calculated Molecular Weight 806 aa, 91 kDa
Observed Molecular Weight 91-100 kDa
GenBank Accession NumberBC113875
Gene Symbol UHRF1
Gene ID (NCBI) 29128
RRIDAB_10860902
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96T88
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2. In addition, UHRF1 is a novel metabolic guardian restricting AMPK activity(PMID: 34907338).

Protocols

Product Specific Protocols
IF protocol for UHRF1 antibody 21402-1-APDownload protocol
IHC protocol for UHRF1 antibody 21402-1-APDownload protocol
IP protocol for UHRF1 antibody 21402-1-APDownload protocol
WB protocol for UHRF1 antibody 21402-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

UHRF1 Polyclonal Antibody (Cat# 21402-1-AP) has accumulated 36 citations across journals including Cancer Cell, Nature Cell Biology, Cell Discovery, Nucleic Acids Research, Theranostics, Advanced Science, Cell Death & Disease, PLoS Biology, Stem Cell Reports, and International Journal of Molecular Sciences. Associated research fields encompass DNA methylation and epigenetic regulation, diverse cancer types (breast, prostate, colorectal, lung, esophageal), stem cell biology, ferroptosis, inflammation, and cardiovascular disease.

SpeciesApplicationTitle
mouse,humanWB

Cancer Cell

Methionine restriction promotes cGAS activation and chromatin untethering through demethylation to enhance antitumor immunity

Authors - Lan Fang
  • KD Validated
humanIF

Nat Cell Biol

Single-cell multi-omics sequencing of human spermatogenesis reveals a DNA demethylation event associated with male meiotic recombination

Authors - Yaping Huang
humanWB

Cell Discov

USP7 negatively controls global DNA methylation by attenuating ubiquitinated histone-dependent DNMT1 recruitment.

Authors - Jialun Li
  • KD Validated
humanWB,IF

Nucleic Acids Res

SET8 prevents excessive DNA methylation by methylation-mediated degradation of UHRF1 and DNMT1.

Authors - Huifang Zhang
humanWB

Theranostics

A feedforward circuit shaped by ECT2 and USP7 contributes to breast carcinogenesis.

Authors - Qi Zhang
humanWB

Adv Sci (Weinh)

Discovery of a Novel DNMT1 Inhibitor with Improved Efficacy in Treating β-Thalassemia

Authors - Yijie Shen

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The antibody received a 5-star rating from a user who tested it for Western blot in mammalian cells. The reviewer reported that it worked well for their application. Overall, the single review reflects a positive experience with the product's performance in WB.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Leo (Verified Customer) (12-12-2024)

The antibody worked well for Western blot in mammalian cells.

  • Applications: Western Blot
Loading...
||
New chat

Able™

正在加载,请稍候...