Tested Applications
| Positive WB detected in | HuH-7 cells, HEK-293T cells, HeLa cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human lung cancer tissue, mouse thymus tissue, rat thymus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21402-1-AP targets UHRF1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16111 Product name: Recombinant human UHRF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-392 aa of BC113875 Sequence: QSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRE Predict reactive species |
| Full Name | ubiquitin-like with PHD and ring finger domains 1 |
| Calculated Molecular Weight | 806 aa, 91 kDa |
| Observed Molecular Weight | 91-100 kDa |
| GenBank Accession Number | BC113875 |
| Gene Symbol | UHRF1 |
| Gene ID (NCBI) | 29128 |
| RRID | AB_10860902 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96T88 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2. In addition, UHRF1 is a novel metabolic guardian restricting AMPK activity(PMID: 34907338).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UHRF1 antibody 21402-1-AP | Download protocol |
| IHC protocol for UHRF1 antibody 21402-1-AP | Download protocol |
| IP protocol for UHRF1 antibody 21402-1-AP | Download protocol |
| WB protocol for UHRF1 antibody 21402-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
UHRF1 Polyclonal Antibody (Cat# 21402-1-AP) has accumulated 36 citations across journals including Cancer Cell, Nature Cell Biology, Cell Discovery, Nucleic Acids Research, Theranostics, Advanced Science, Cell Death & Disease, PLoS Biology, Stem Cell Reports, and International Journal of Molecular Sciences. Associated research fields encompass DNA methylation and epigenetic regulation, diverse cancer types (breast, prostate, colorectal, lung, esophageal), stem cell biology, ferroptosis, inflammation, and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Cancer Cell Methionine restriction promotes cGAS activation and chromatin untethering through demethylation to enhance antitumor immunity
| ||
Nat Cell Biol Single-cell multi-omics sequencing of human spermatogenesis reveals a DNA demethylation event associated with male meiotic recombination | ||
Cell Discov USP7 negatively controls global DNA methylation by attenuating ubiquitinated histone-dependent DNMT1 recruitment.
| ||
Nucleic Acids Res SET8 prevents excessive DNA methylation by methylation-mediated degradation of UHRF1 and DNMT1. | ||
Theranostics A feedforward circuit shaped by ECT2 and USP7 contributes to breast carcinogenesis. | ||
Adv Sci (Weinh) Discovery of a Novel DNMT1 Inhibitor with Improved Efficacy in Treating β-Thalassemia |
Reviews
What customers say
The antibody received a 5-star rating from a user who tested it for Western blot in mammalian cells. The reviewer reported that it worked well for their application. Overall, the single review reflects a positive experience with the product's performance in WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Leo (Verified Customer) (12-12-2024) | The antibody worked well for Western blot in mammalian cells.
|















