Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, mouse brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse testis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 17 publications below |
| IHC | See 2 publications below |
| IF | See 9 publications below |
Product Information
10702-1-AP targets VAMP3/Cellubrevin in WB, IHC, IF, IP, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1156 Product name: Recombinant human VAMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC005941 Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS Predict reactive species |
| Full Name | vesicle-associated membrane protein 3 (cellubrevin) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11-17 kDa |
| GenBank Accession Number | BC005941 |
| Gene Symbol | VAMP3 |
| Gene ID (NCBI) | 9341 |
| RRID | AB_2212628 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15836 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP3, also named as cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VAMP3/Cellubrevin antibody 10702-1-AP | Download protocol |
| IP protocol for VAMP3/Cellubrevin antibody 10702-1-AP | Download protocol |
| WB protocol for VAMP3/Cellubrevin antibody 10702-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Engineered Cell-Derived Microparticles Bi2Se3/DOX@MPs for Imaging Guided Synergistic Photothermal/Low-Dose Chemotherapy of Cancer. | ||
Adv Sci (Weinh) Early Endosomes Act as Local Exocytosis Hubs to Repair Endothelial Membrane Damage | ||
Aging Cell Knockdown of astrocytic Grin2a aggravates β-amyloid-induced memory and cognitive deficits through regulating nerve growth factor. | ||
Oncogene Syntaxin-6 mediated autophagy confers lenvatinib resistance in hepatocellular carcinoma | ||
Oncotarget A novel liver metastasis-correlated protein of pancreatic neuroendocrine neoplasm (PanNEN) discovered by proteomic analysis. |















