Tested Applications
| Positive WB detected in | SGC-7901 cells, Jurkat cells |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | rat cerebellum tissue, mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20873-1-AP targets VMAT2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14971 Product name: Recombinant human VMAT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-127 aa of BC108928 Sequence: VVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNE Predict reactive species |
| Full Name | solute carrier family 18 (vesicular monoamine), member 2 |
| Calculated Molecular Weight | 514 aa, 56 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC108928 |
| Gene Symbol | VMAT2 |
| Gene ID (NCBI) | 6571 |
| RRID | AB_10858619 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05940 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VMAT2 is a vesicular monoamine transporter that is responsible for the uptake and storage of monoamines (dopaine, norepinephrine, epinephrine, histamine and serotonin) in neurons, endocrine cells, and tumors deriving from these cells. Histamine-producing endocrine tumors (gastric carcinoids) expressed VMAT2 almost exclusively, thus VMAT2 is useful in classification of neuroendocrine tumors. Reduced expression of VMAT2 has often been observed in Parkinson's diseased (PD) brain, and detection of VMAT2 can be used to reflect the 4-(2-aminoethyl)benzene-1,2-diol neuron loss and predict the disease process. Several forms of VMAT2 can be observed upon the glycosylation: 45 kDa band corresponds to the native (deglycosylated) form, and the 55 and 75 kDa bands to glycosylated forms (PMID: 17582657).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VMAT2 antibody 20873-1-AP | Download protocol |
| WB protocol for VMAT2 antibody 20873-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VMAT2 Polyclonal antibody (Cat# 20873-1-AP) has 13 citations published in journals including Nature, Nature Genetics, EMBO Journal, Molecular Neurodegeneration, Molecular Medicine, Food & Function, Biological Research, Brain Research Bulletin, Frontiers in Neuroscience, Disease Models & Mechanisms, Research, and Parkinson's Disease. The research fields span Parkinson's disease, dopaminergic neurodegeneration, dopamine signaling, hyperactivity disorder, post-stroke depression, and neuroendocrine tumor classification.
| Species | Application | Title |
|---|---|---|
Mol Neurodegener Pathological characteristics of axons and alterations of proteomic and lipidomic profiles in midbrain dopaminergic neurodegeneration induced by WDR45-deficiency | ||
Research (Wash D C) Single-Cell Profiling Identifies Reward Behavior-Related Neurons and Alterations in the Ventral Tegmental Area Based on Arvcf-Knockout Mouse Model. | ||
EMBO J The selenocysteine-containing protein SELENOT maintains dopamine signaling in the midbrain to protect mice from hyperactivity disorder | ||
Mol Med Differentiation of adult human retinal pigment epithelial cells into dopaminergic-like cells in vitro and in the recipient monkey brain. |
Reviews
What customers say
The single review for 20873-1-AP comes from a researcher (N. Chen) who used it for Western Blot at a 1:2000 dilution on mouse brain lysate. They rated it 5 stars, noting it works well for detecting endogenous VMAT2 in mouse brain with an expected molecular weight of approximately 60 kD. Overall, the feedback is positive, confirming reliable performance for its intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
N (Verified Customer) (11-24-2025) | A good Ab to detect endo VMAT2 in the mouse brain with a MW of about 60kD.
 |
