Tested Applications
| Positive WB detected in | SGC-7901 cells, Jurkat cells |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | rat cerebellum tissue, mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
Product Information
20873-1-AP targets VMAT2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14971 Product name: Recombinant human VMAT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-127 aa of BC108928 Sequence: VVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNE Predict reactive species |
| Full Name | solute carrier family 18 (vesicular monoamine), member 2 |
| Calculated Molecular Weight | 514 aa, 56 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC108928 |
| Gene Symbol | VMAT2 |
| Gene ID (NCBI) | 6571 |
| RRID | AB_10858619 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05940 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VMAT2 is a vesicular monoamine transporter that is responsible for the uptake and storage of monoamines (dopaine, norepinephrine, epinephrine, histamine and serotonin) in neurons, endocrine cells, and tumors deriving from these cells. Histamine-producing endocrine tumors (gastric carcinoids) expressed VMAT2 almost exclusively, thus VMAT2 is useful in classification of neuroendocrine tumors. Reduced expression of VMAT2 has often been observed in Parkinson's diseased (PD) brain, and detection of VMAT2 can be used to reflect the 4-(2-aminoethyl)benzene-1,2-diol neuron loss and predict the disease process. Several forms of VMAT2 can be observed upon the glycosylation: 45 kDa band corresponds to the native (deglycosylated) form, and the 55 and 75 kDa bands to glycosylated forms (PMID: 17582657).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VMAT2 antibody 20873-1-AP | Download protocol |
| WB protocol for VMAT2 antibody 20873-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Dis Model Mech A Matrigel-based 3D construct of SH-SY5Y cells models the α-synuclein pathologies of Parkinson's disease. | ||
Front Neurosci Behavioral and histological analyses of the mouse Bassoon p.P3882A mutation corresponding to the human BSN p.P3866A mutation | ||
EMBO J The selenocysteine-containing protein SELENOT maintains dopamine signaling in the midbrain to protect mice from hyperactivity disorder |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH N (Verified Customer) (11-24-2025) | A good Ab to detect endo VMAT2 in the mouse brain with a MW of about 60kD.
![]() |










