Tested Applications
| Positive WB detected in | HepG2 cells, A549 cells, HAP1 cells, HEK-293 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10236-1-AP targets VPS35 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0340 Product name: Recombinant human VPS35 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002414 Sequence: MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ Predict reactive species |
| Full Name | vacuolar protein sorting 35 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 92 kDa |
| Observed Molecular Weight | 80-92 kDa |
| GenBank Accession Number | BC002414 |
| Gene Symbol | VPS35 |
| Gene ID (NCBI) | 55737 |
| RRID | AB_2215216 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96QK1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VPS35 protein belongs to a group of vacuolar protein sorting (VPS) proteins, which ensure the proper delivery of organelle-specific proteins in eukaryotic cells. VPS35 is the core of a multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Vps35 serves as the core of the multimeric complex by binding directly to Vps26 and Vps29 and SNX1. Northern blot analyses in 16 tissues showed that one transcript of Vps35 with a size of 3.6 kb was highly expressed in brain, heart, testis, ovary, small intestine, spleen, skeletal muscle, and placenta and expressed at moderate or low levels in other tissues. Another transcript of Vps35, a message of 3.0 kb, was also expressed with proportionally lower levels than the 3.6-kb transcript in all the tissues except that the 3.0-kb transcript was not detected in brain. Human Vps35 is mapped at 16q13-q21.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VPS35 antibody 10236-1-AP | Download protocol |
| IHC protocol for VPS35 antibody 10236-1-AP | Download protocol |
| IP protocol for VPS35 antibody 10236-1-AP | Download protocol |
| WB protocol for VPS35 antibody 10236-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
VPS35 Polyclonal antibody (Cat# 10236-1-AP) has 24 citations published in journals including Nature Communications, PNAS, Cell Metabolism, Cell Death & Differentiation, Autophagy, Advanced Science, Cell Reports, Glia, and Human Molecular Genetics. Research fields span endosomal/retromer trafficking, viral infections (SARS-CoV-2, HIV-1), heart failure, liver fibrosis, Parkinson's disease, inflammatory bowel disease, diabetes, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Cell Metab EHBP1 suppresses liver fibrosis in metabolic dysfunction-associated steatohepatitis | ||
Autophagy WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway. | ||
Nat Commun A genome-wide CRISPR screen identifies host factors that regulate SARS-CoV-2 entry. | ||
Adv Sci (Weinh) Loss of VMP1 Impairs Tight Junction Recycling and Aggravates Intestinal Barrier Dysfunction in Inflammatory Bowel Disease. | ||
Cell Death Differ Sorting nexin 3 induces heart failure via promoting retromer-dependent nuclear trafficking of STAT3. | ||
Cell Death Dis Targeting sorting nexin 3 to treat pulmonary fibrosis by dual modulating Wnt/β-catenin signaling. |
Reviews
What customers say
Both reviewers report positive results with this anti-VPS35 antibody. One user (5/5) used it at 1:2000 for Western Blot on mouse brain lysate and described it as "a very good antibody to detect endogenous VPS35." The other (4/5) applied it at 1:300 for immunofluorescence on mouse OC2 cells, co-staining with DAPI and Phalloidin-647 to visualize DNA and F-actin. Overall, the antibody performs well for both WB and IF applications in mouse samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xin (Verified Customer) (10-10-2022) | A very good antibody to detect endogenous VPS35 in mouse brain lysate.
 |
stephen (Verified Customer) (09-07-2019) | Oc-2 cells fixed with 4% PFA Perm. by 0.3% tx100 for 5 min blocked with 1% BSA in 1XPBS for 2 hours vps35 antibody incubated 1:300 overnight at 4 degrees in 1%BSA in 1x PBS. Co-stained with DAPI (blue) and Ph647 (red) to visualize DNA and F-actin respectively.
 |
