Tested Applications
| Positive WB detected in | K-562 cells, A431 cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue, MOLT-4 cells |
| Positive IP detected in | K-562 cells |
| Positive IF/ICC detected in | K-562 cells |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 29 publications below |
| IHC | See 1 publications below |
| IF | See 21 publications below |
| ChIP | See 6 publications below |
Product Information
12609-1-AP targets WT1 in WB, IF/ICC, FC (Intra), IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3337 Product name: Recombinant human WT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC032861 Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL Predict reactive species |
| Full Name | Wilms tumor 1 |
| Calculated Molecular Weight | 449 aa, 49 kDa, 57 kDa |
| Observed Molecular Weight | 52-55 kDa |
| GenBank Accession Number | BC032861 |
| Gene Symbol | WT1 |
| Gene ID (NCBI) | 7490 |
| RRID | AB_2216225 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19544 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. Function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. WT1 exists some isoforms with the range of molecular weight is 33-50 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for WT1 antibody 12609-1-AP | Download protocol |
| IF protocol for WT1 antibody 12609-1-AP | Download protocol |
| IP protocol for WT1 antibody 12609-1-AP | Download protocol |
| WB protocol for WT1 antibody 12609-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell The IMiD target CRBN determines HSP90 activity toward transmembrane proteins essential in multiple myeloma. | ||
Mol Psychiatry Brain-specific Wt1 deletion leads to depressive-like behaviors in mice via the recruitment of Tet2 to modulate Epo expression.
| ||
EMBO Mol Med Inhibition of Aurora Kinase B attenuates fibroblast activation and pulmonary fibrosis. | ||
Oncogene YAP induces high-grade serous carcinoma in fallopian tube secretory epithelial cells. | ||
Oncogene USP13 promotes development and metastasis of high-grade serous ovarian carcinoma in a novel mouse model. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sandrine (Verified Customer) (12-17-2021) | clean signal for IP and western blot. Good relative enrichment for ChIP assays.
|
FH K (Verified Customer) (12-20-2020) | This Ab worked well for IHC (1:200) but I could't get satisfactory results for western blotting.
|

















