• Featured Product
  • KD/KO Validated

ZC3HAV1 Polyclonal antibody

ZC3HAV1 Polyclonal Antibody for WB, IP, ELISA
Cat No. 16820-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, RIP, ELISA

ZAP, PRO1677, PARP13, Inactive Poly [ADP-ribose] polymerase 13, ARTD13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16820-1-AP targets ZC3HAV1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10364

Product name: Recombinant human ZC3HAV1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC025308

Sequence: MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLAS

Predict reactive species
Full Name zinc finger CCCH-type, antiviral 1
Calculated Molecular Weight699aa,78 kDa; 902aa,101 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC025308
Gene Symbol ZC3HAV1
Gene ID (NCBI) 56829
RRIDAB_2728733
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7Z2W4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The zinc-finger antiviral protein (ZAP) was originally identifed from a rat cDNA library due to its conferring resistance to retroviruses. ZC3HAV1 is a CCCH-type zinc finger protein, it may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms. ZC3HAV1 exists some isoforms with MV 101, 77, 67, 42 and 18 kDa.

Protocols

Product Specific Protocols
IHC protocol for ZC3HAV1 antibody 16820-1-APDownload protocol
IP protocol for ZC3HAV1 antibody 16820-1-APDownload protocol
WB protocol for ZC3HAV1 antibody 16820-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

CG dinucleotide suppression enables antiviral defence targeting non-self RNA.

Authors - Matthew A Takata
  • KD Validated
humanWB

Cell

SCAF4 and SCAF8, mRNA Anti-Terminator Proteins.

Authors - Lea H Gregersen

Cell Host Microbe

HIV-1 matrix-tRNA complex structure reveals basis for host control of Gag localization.

Authors - Charles Bou-Nader
humanWB

Nat Microbiol

Rational attenuation of RNA viruses with zinc finger antiviral protein

Authors - Daniel Gonçalves-Carneiro
humanWB,IP

Nat Commun

The short isoform of the host antiviral protein ZAP acts as an inhibitor of SARS-CoV-2 programmed ribosomal frameshifting.

Authors - Matthias M Zimmer
humanWB

Nucleic Acids Res

Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR.

Authors - Evan P Booy

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sven (Verified Customer) (08-05-2025)

I used the AB for WB, it worked very well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/6000
  • Cell Tissue Type: HEK-293
FH

Lisa (Verified Customer) (08-05-2025)

Works perfectly for WB even highly diluted um to 1:20000

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:6000
  • Cell Tissue Type: HEK293, U2OS
FH

Saul (Verified Customer) (07-23-2025)

really nice sharp signal even at quite high dilution

  • Applications: Western Blot
  • Primary Antibody Dilution: 1.6000
  • Cell Tissue Type: U2OS cell line
FH

Daniel (Verified Customer) (10-26-2022)

This is a fantastic antibody. It works very reliably at high dilutions.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK293T, HELA, MT4, SupT1
ZC3HAV1 Antibody Western Blot validation (1:5000 dilution) in HEK293T, HELA, MT4, SupT1 (Cat no:16820-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...