Validation Data Gallery
Product Information
Kit for IP/Co-IP of Strep-tagged proteins and sample preparations for mass spectrometry (MS)
Description | The iST HA-Trap Kit enables researchers to process Strep-tagged proteins and their interacting partners for mass spectrometry analysis by including the ChromoTek Strep-NanoTrap for IP /Co-IP of Strep-tagged proteins and the PreOmics iST buffers and cartridges required for bottom-up proteomic sample preparation. This robust method yields purified peptides while dramatically reducing contamination and sample loss. Each kit accomodates up to eight samples and includes pull-down material for 2 controls. |
Applications | IP, Co-IP, MS |
Specificity/Target | Binds specifically to the peptide sequence SAWSHPQFEK, also known as Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this trap binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position. |
Binding Capacity | 25 ug of recombinant SAWSHPQFEK-tagged protein (~30 kDa) per 25 uL bead slurry |
Conjugate | Agarose beads; ~90 um (cross-linked 4% agarose beads) |
Type | Nanobody |
Class | Recombinant |
Host | Alpaca |
Affinity (KD) | 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag® |
Compatibility with mass spectrometry | The Strep-NanoTrap is optimized for on-bead digestion. |
Storage Buffer | 20% ethanol |
Storage Condition | Shipped at ambient temperature. Upon receipt store Strep-NanoTrap at +4°C and Digest at -20°C. |
Kit components
Component | Description |
---|---|
Strep-NanoTrap Agarose | 8 reactions plus 2 controls |
Digest | Enzyme Trypsin-mix to digest proteins |
Resuspend buffer | Protease reconstitution buffer for enzymes |
Lyse buffer | Denature, reduce, and alkylate proteins |
Stop solution | Stop the enzymatic activity |
Wash 1 buffer | Clean up peptides from hydrophobic contaminants |
Wash 2 buffer | Clean up peptides from hydrophillic contaminants |
Elution buffer | Elute peptides from the cartridge |
LC-Load | Load peptides on reversed-phase LC-MS column |
Cartridges | Cartridge for 1 to 100 ug protein starting material |
Waste Tubes | Tube for collecting waste after washing steps |
Collection Tubes | Tube for collecting peptides after elution |
Adapters | Enables placing a cartridge into a tube |
Caps | Cap to optionally close the cartridge's bottom |