Recombinant human ANKS1B protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag20454
Synonyms
AIDA; AIDA-1; ANKS2; EB-1; EB1; MGC26087; cajalin-2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
(446-510 aa encoded by BC026313) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
