Recombinant human BATF protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag4418
Synonyms
B-ATF; BATF1; SFA-2; SFA2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
(1-125 aa encoded by BC032294) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
