Recombinant human BDNF protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag28276
Synonyms
BDNF, BDNF precursor form, brain derived neurotrophic factor, Brain-derived neurotrophic factor
Validation Data Gallery View All
Product Information
| Peptide Sequence |
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
(129-247 aa encoded by BC029795) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
