Tested Applications
| Positive WB detected in | HT-29 cells, HEK-293 cells, HeLa cells, K-562 cells, Jurkat cells, NIH/3T3 cells |
| Positive IHC detected in | human lymphoma tissue, human malignant melanoma tissue, human testis tissue, human thyroid cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20899-1-AP targets BRAF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15014 Product name: Recombinant human BRAF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 500-766 aa of BC101757 Sequence: NEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH Predict reactive species |
| Full Name | v-raf murine sarcoma viral oncogene homolog B1 |
| Calculated Molecular Weight | 766 aa, 84 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC101757 |
| Gene Symbol | BRAF |
| Gene ID (NCBI) | 673 |
| RRID | AB_2878760 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15056 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
B-Raf proto-oncogene serine/threonine kinase(BRAF), is a protein belonging to the raf/mil family of serine/threonine protein kinases. BRAF plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. BRAF is associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. BRAF is also associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. BRAF plays a role in the PD-1/PDL-1 pathway. In some cancers, BRAF is activated by rearrangements that fuse its kinase domain to 5' partner genes and then has different molecular weights (PMID: 23890088). BRAF has several isoforms, the calculated molecular weight of BRAF is 84 kDa, but the observed molecular weight is about 65 kDa(isoform).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BRAF antibody 20899-1-AP | Download protocol |
| IHC protocol for BRAF antibody 20899-1-AP | Download protocol |
| WB protocol for BRAF antibody 20899-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BRAF polyclonal antibody (Cat# 20899-1-AP) has 25 citations published in journals including Cell Discovery, EMBO Reports, NPJ Precision Oncology, Acta Biomaterialia, Life Sciences, International Journal of Cancer, Frontiers in Immunology, Cells, Heliyon, Gene, Aging, and others. Research fields span oncology (melanoma, ovarian, thyroid, gastric, colorectal, glioma, thymoma), MAPK/ERK signaling, pharmacology, proteomics, aging, reproductive biology, and veterinary science. Applications are predominantly WB, with some IF and IHC.
| Species | Application | Title |
|---|---|---|
Acta Pharmacol Sin 1-Indanone retards cyst development in ADPKD mouse model by stabilizing tubulin and down-regulating anterograde transport of cilia | ||
Acta Biomater A biodegradable lipid nanoparticle delivers a Cas9 ribonucleoprotein for efficient and safe in situ genome editing in melanoma | ||
NPJ Precis Oncol GLUD1 supports ovarian cancer progression by counteracting anoikis via ARAF/MEK/ERK signaling. | ||
J Eur Acad Dermatol Venereol Differentially expressed proteins identified by TMT proteomics analysis in children with verrucous epidermal naevi. | ||
Front Immunol Immune Dysfunction Mediated by the ceRNA Regulatory Network in Human Placenta Tissue of Intrahepatic Cholestasis Pregnancy. |
Reviews
What customers say
One reviewer rated this antibody 4/5 stars for immunofluorescence on human brain cortex at 1:100 dilution. They reported that BRAF staining appeared weak but specific, successfully marking some NeuN-positive neurons in TSC cortical samples. Overall, the antibody demonstrated specificity but with lower-than-expected signal intensity in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Reyes (Verified Customer) (09-24-2025) | BRAF (in green) seemed to work weakly but specifically in human brain cortical samples of TSC marking some NeuN-positive neurons (in red)
 |
