Tested Applications
| Positive WB detected in | L02 cells, human blood, mouse liver tissue |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:4000-1:40000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
22233-1-AP targets C4 Alpha Chain/C4b/C4d in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17583 Product name: Recombinant human C4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1017-1336 aa of BC063289 Sequence: YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEIASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTQAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR Predict reactive species |
| Full Name | complement component 4A (Rodgers blood group) |
| Calculated Molecular Weight | 1744 aa, 193 kDa |
| Observed Molecular Weight | 80-95 kDa, 200 kDa |
| GenBank Accession Number | BC063289 |
| Gene Symbol | C4 Gamma Chain |
| Gene ID (NCBI) | 720 |
| RRID | AB_2879042 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P0C0L4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1017-1336aa of human C4-A protein can recognize C4 precursor, C4 alpha chain, C4b, and C4d.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for C4 Alpha Chain/C4b/C4d antibody 22233-1-AP | Download protocol |
| IP protocol for C4 Alpha Chain/C4b/C4d antibody 22233-1-AP | Download protocol |
| WB protocol for C4 Alpha Chain/C4b/C4d antibody 22233-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Complement components regulates ferroptosis in CVB3 viral myocarditis by interatction with TFRC
| ||
Cell Biochem Funct In silico analysis and verification of critical genes related to vascular calcification in multiple diseases | ||
Immunobiology Inefficient and abortive classical complement pathway activation by the calcium inositol hexakisphosphate component of the Echinococcus granulosus laminated layer. | ||
Transplant Direct Circulating Donor Heart Exosome Profiling Enables Noninvasive Detection of Antibody-mediated Rejection. | ||











