Recombinant human CCL4 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag25070
Synonyms
ACT2; AT744.1; G-26; LAG1; MGC104418; MGC126025; MGC126026; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Validation Data Gallery View All
Product Information
| Peptide Sequence |
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
(24-92 aa encoded by BC107433) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
