CCL4 Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Powder

Cat no : Ag25070

Synonyms

ACT2; AT744.1; G-26; LAG1; MGC104418; MGC126025; MGC126026; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4



Product Information

Peptide Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
(24 - 92 aa encoded by BC107433)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Purity60%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.