Tested Applications
| Positive WB detected in | NIH/3T3 cells, human heart tissue, mouse brain tissue, human ileum tissue, human kidney tissue, human placenta tissue, human brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, human liver cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, PFA fixed cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12527-1-AP targets CHMP2B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3222 Product name: Recombinant human CHMP2B protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-213 aa of BC001553 Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Predict reactive species |
| Full Name | chromatin modifying protein 2B |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC001553 |
| Gene Symbol | CHMP2B |
| Gene ID (NCBI) | 25978 |
| RRID | AB_10603358 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2 2, belongs to the chromatin-modifying protein / charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which involves in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHMP2B antibody 12527-1-AP | Download protocol |
| IHC protocol for CHMP2B antibody 12527-1-AP | Download protocol |
| WB protocol for CHMP2B antibody 12527-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CHMP2B Polyclonal antibody (Cat# 12527-1-AP) has 29 citations. These appear in journals including Nature Cell Biology, Autophagy, Nature Communications, ACS Nano, Molecular Cell, Theranostics, Cell Death & Disease, PLoS Pathogens, Science Reports, Journal of Neuroscience, Journal of Virology, Oncotarget, and Current Biology. Research fields span autophagy and lysosomal repair, ESCRT-III/endosomal trafficking, Alzheimer's disease and neurodegeneration, viral infection, acute kidney injury, cancer drug resistance, iron metabolism, and cell division. Applications include WB, IF, IHC, IP, and ELISA.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation. | ||
Nat Cell Biol Proteostasis and lysosomal repair deficits in transdifferentiated neurons of Alzheimer's disease | ||
Autophagy ESCRT iii-mediated lysosomal repair improve renal tubular cell injury in cisplatin-induced AKI | ||
Autophagy Classical swine fever virus hijacks ESCRT-III and VPS4A to promote phagophore closure for accelerating mitophagy. | ||
Nat Commun TMEM55B links autophagy flux, lysosomal repair, and TFE3 activation in response to oxidative stress | ||
ACS Nano A Type I/II Photosensitizer with Lysosome-Targeting Capabilities Induces Immunogenic Cell Death in Cancer Cells to Enhance Tumor Immunotherapy. |
Reviews
What customers say
The product has one review rated 4 out of 5 stars. The reviewer used it for Western Blot, Immunofluorescence, Flow Cytometry, and Cell culture applications at a 1:500 dilution on i3Neurons, and included an image but no written comments. Overall, the feedback suggests satisfactory performance across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Cristina (Verified Customer) (06-19-2025) | None
 |
