• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CHMP2B Polyclonal antibody

CHMP2B Polyclonal Antibody for IF/ICC
Cat No. CL488-12527

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

hVps2 2, DMT1, Chromatin-modifying protein 2b, chromatin modifying protein 2B, CHMP2.5

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12527 targets CHMP2B in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3222

Product name: Recombinant human CHMP2B protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-213 aa of BC001553

Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD

Predict reactive species
Full Name chromatin modifying protein 2B
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC001553
Gene Symbol CHMP2B
Gene ID (NCBI) 25978
RRIDAB_3672542
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UQN3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2 2, belongs to the chromatin-modifying protein / charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which involves in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CHMP2B antibody CL488-12527Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...