Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CLPP Polyclonal antibody

CLPP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15698-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Endopeptidase Clp, EC:3.4.21.92, ATP-dependent Clp protease proteolytic subunit, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, rat heart tissue, K-562 cells, mouse heart tissue
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inhuman liver cancer tissue, human kidney tissue, human testis tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15698-1-AP targets CLPP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken, zebrafish, goat, c.elegans
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8325

Product name: Recombinant human CLPP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC002956

Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Predict reactive species
Full Name ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 26 kDa, 30 kDa
GenBank Accession NumberBC002956
Gene Symbol CLPP
Gene ID (NCBI) 8192
RRIDAB_2245115
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16740
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid.

Protocols

Product Specific Protocols
IF protocol for CLPP antibody 15698-1-APDownload protocol
IHC protocol for CLPP antibody 15698-1-APDownload protocol
IP protocol for CLPP antibody 15698-1-APDownload protocol
WB protocol for CLPP antibody 15698-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
WB

Cell Metab

Fibroblast Growth Factor 21 Drives Dynamics of Local and Systemic Stress Responses in Mitochondrial Myopathy with mtDNA Deletions.

Authors - Saara Forsström

Nat Metab

LONP1 regulation of mitochondrial protein folding provides insight into beta cell failure in type 2 diabetes

Authors - Jin Li
mouseWB

Cell Metab

mTORC1 Regulates Mitochondrial Integrated Stress Response and Mitochondrial Myopathy Progression.

Authors - Nahid A Khan
humanWB

Mol Cell

The mitochondrial DNAJC co-chaperone TCAIM reduces α-ketoglutarate dehydrogenase protein levels to regulate metabolism

Authors - Wang Jiahui
  • KD Validated
mouseWB

Cell Metab

Proteolytic cleavage of opa1 stimulates mitochondrial inner membrane fusion and couples fusion to oxidative phosphorylation.

Authors - Prashant Mishra
mouseWB

Sci Adv

Mitochondrial proteostasis stress in muscle drives a long-range protective response to alleviate dietary obesity independently of ATF4.

Authors - Qiqi Guo

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Anh (Verified Customer) (07-15-2021)

very good, very clear bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: heart cells

Mariusz (Verified Customer) (02-06-2019)

Excellent antibody bot for Western blot (1:2000) dilution and immunofluorescence (1:200). Single band on Western, and clean signal reflecting mitochondrial matrix in IF.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:2000 (Western), 1:200 (IF)
  • Cell Tissue Type: HeLa and HCt116
Loading...
||
New chat

Able

正在加载,请稍候...