Tested Applications
Positive WB detected in | human placenta tissue, rat heart tissue, K-562 cells, mouse heart tissue |
Positive IP detected in | mouse skeletal muscle tissue |
Positive IHC detected in | human liver cancer tissue, human kidney tissue, human testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 49 publications below |
IHC | See 3 publications below |
IF | See 3 publications below |
CoIP | See 1 publications below |
Product Information
15698-1-AP targets CLPP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, chicken, zebrafish, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8325 Product name: Recombinant human CLPP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC002956 Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Predict reactive species |
Full Name | ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) |
Calculated Molecular Weight | 30 kDa |
Observed Molecular Weight | 26 kDa, 30 kDa |
GenBank Accession Number | BC002956 |
Gene Symbol | CLPP |
Gene ID (NCBI) | 8192 |
RRID | AB_2245115 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16740 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CLPP antibody 15698-1-AP | Download protocol |
IHC protocol for CLPP antibody 15698-1-AP | Download protocol |
IF protocol for CLPP antibody 15698-1-AP | Download protocol |
IP protocol for CLPP antibody 15698-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab Fibroblast Growth Factor 21 Drives Dynamics of Local and Systemic Stress Responses in Mitochondrial Myopathy with mtDNA Deletions. | ||
Cell Metab mTORC1 Regulates Mitochondrial Integrated Stress Response and Mitochondrial Myopathy Progression. | ||
Mol Cell The mitochondrial DNAJC co-chaperone TCAIM reduces α-ketoglutarate dehydrogenase protein levels to regulate metabolism
| ||
Cell Metab Proteolytic cleavage of opa1 stimulates mitochondrial inner membrane fusion and couples fusion to oxidative phosphorylation. | ||
Sci Adv Mitochondrial proteostasis stress in muscle drives a long-range protective response to alleviate dietary obesity independently of ATF4. | ||
Nat Commun Disuse-associated loss of the protease LONP1 in muscle impairs mitochondrial function and causes reduced skeletal muscle mass and strength. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Anh (Verified Customer) (07-15-2021) | very good, very clear bands
|
FH Mariusz (Verified Customer) (02-06-2019) | Excellent antibody bot for Western blot (1:2000) dilution and immunofluorescence (1:200). Single band on Western, and clean signal reflecting mitochondrial matrix in IF.
|