Filter: AllWBIPIHCIF/ICC

WB analysis using 13002-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
WB analysis of NIH/3T3 using 13002-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 13002-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HL-60 using 13002-1-AP
HL-60 cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HT-1080 using 13002-1-AP
HT-1080 cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.
IP experiment of HeLa using 13002-1-AP
IP result of anti-CUGBP1 (IP:13002-1-AP, 4ug; Detection:13002-1-AP 1:500) with HeLa cells lysate 3200ug.
IHC staining of human breast cancer using 13002-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13002-1-AP (CUGBP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human skin cancer using 13002-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50.
IHC staining of human skin cancer using 13002-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50.
IHC staining of human testis using 13002-1-AP
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human testis using 13002-1-AP
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 13002-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13002-1-AP (CUGBP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HeLa using 13002-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CUGBP1 antibody (13002-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

Featured Product
KD/KO Validated

CUGBP1 Polyclonal antibody

Name: CUGBP1 Polyclonal antibody
Brand: Proteintech
SKU: 13002-1-AP

CUGBP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13002-1-AP

Publications(6)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CELF1, CELF 1, Bruno-like protein 2, BRUNOL2, Bruno like protein 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (6)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HL-60 cells, HeLa cells, NIH/3T3 cells, HT-1080 cells, mouse brain tissue, rat brain tissue
Positive IP detected in	HeLa cells
Positive IHC detected in	human breast cancer tissue, human skin cancer tissue, human testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 4 publications below
IHC	See 1 publications below
IP	See 1 publications below

Product Information

13002-1-AP targets CUGBP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3677 Product name: Recombinant human CUGBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 107-479 aa of BC031079 Sequence: DRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKND Predict reactive species
Full Name	CUG triplet repeat, RNA binding protein 1
Calculated Molecular Weight	483 aa, 52 kDa
Observed Molecular Weight	51-55 kDa
GenBank Accession Number	BC031079
Gene Symbol	CUGBP1
Gene ID (NCBI)	10658
RRID	AB_10642947
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92879
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CUG triplet repeat RNA binding protein 1 (CUGBP1) is a member of the CUGBP Elav-like family (CELF), which plays an important role in cardiac development and function (PMID: 17130239). CUGBP1 has also been shown to localize to cytoplasmic stress granules when cells are stressed.

Protocols

Product Specific Protocols
IF protocol for CUGBP1 antibody 13002-1-AP	Download protocol
IHC protocol for CUGBP1 antibody 13002-1-AP	Download protocol
IP protocol for CUGBP1 antibody 13002-1-AP	Download protocol
WB protocol for CUGBP1 antibody 13002-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
mouse	IHC	Hum Mol Genet CGG repeats in RNA modulate expression of TDP-43 in mouse and fly models of fragile X tremor ataxia syndrome. Authors - Jocelyn N Galloway View Article
human	WB	Carcinogenesis RNA-binding protein CUGBP1 controls the differential INSR splicing in molecular subtypes of breast cancer cells and affects cell aggressiveness. Authors - Gena Huang KD Validated View Article
human	WB	Sci Rep DLX6-AS1 activated by H3K4me1 enhanced secondary cisplatin resistance of lung squamous cell carcinoma through modulating miR-181a-5p/miR-382-5p/CELF1 axis. Authors - Xu Zhao KD Validated View Article
human,mouse	WB	Bioengineered Guizhi Fuling pill attenuates liver fibrosis in vitro and in vivo via inhibiting TGF-β1/Smad2/3 and activating IFN-γ/Smad7 signaling pathways. Authors - Zhongliang Liu View Article
mouse	WB	iScience Insulin receptor isoform B is required for efficient proinsulin processing in pancreatic β cells Authors - Mingchao Jiang View Article
human,mouse,rat	IP	Life Sci Alliance Endo-bind-n-seq: identifying RNA motifs of RNA binding proteins isolated from endogenous sources Authors - Tiana Nicole Hanelt View Article