Filter: AllWBIHCIF/ICC

WB analysis of mouse heart using 13317-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of human heart using 13317-1-AP
human heart tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 13317-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse kidney using 13317-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse spleen using 13317-1-AP
mouse spleen tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse lung using 13317-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse small intestine using 13317-1-AP
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of Transfected HEK-293 using 13317-1-AP
Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse stomach using 13317-1-AP
mouse stomach tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of mouse small intestine using 13317-1-AP
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of human uterus using 13317-1-AP
human uterus tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of PC-3 using 13317-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
WB analysis of rat kidney using 13317-1-AP
rat kidney tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 13317-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 13317-1-AP (Cytoglobin antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
IHC staining of human liver cancer using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer using 13317-1-AP (Cytoglobin antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human liver cancer using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer using 13317-1-AP (Cytoglobin antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human heart using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 13317-1-AP (Cytoglobin antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human heart using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 13317-1-AP (Cytoglobin antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human liver using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 13317-1-AP (Cytoglobin antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human liver using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 13317-1-AP (Cytoglobin antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human prostate cancer using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13317-1-AP (Cytoglobin antibody at dilution of 1:50 (under 10x lens).
IHC staining of human prostate cancer using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13317-1-AP (Cytoglobin antibody at dilution of 1:50 (under 40x lens).
IHC staining of human heart using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13317-1-AP (Cytoglobin antibody at dilution of 1:50 (under 10x lens).
IHC staining of human heart using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13317-1-AP (Cytoglobin antibody at dilution of 1:50 (under 40x lens).
IHC staining of human stomach using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13317-1-AP (Cytoglobin antibody at dilution of 1:50 (under 10x lens).
IHC staining of human stomach using 13317-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13317-1-AP (Cytoglobin antibody at dilution of 1:50 (under 40x lens).
IF Staining of HeLa using 13317-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Cytoglobin antibody (13317-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).
IF Staining of HeLa using 13317-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Cytoglobin antibody (13317-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Featured Product
KD/KO Validated

Cytoglobin Polyclonal antibody

Cytoglobin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13317-1-AP

Publications(9)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CYGB, EC:1.11.1.-, EC:1.14.12.-, EC:1.15.1.1, EC:1.7.-.-

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (9)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue, human heart tissue, human uterus tissue, mouse brain tissue, mouse kidney tissue, mouse lung tissue, mouse small intestine tissue, mouse spleen tissue, mouse stomach tissue, PC-3 cells, rat kidney tissue, Transfected HEK-293 cells
Positive IHC detected in	human liver cancer tissue, human heart tissue, human liver tissue, human prostate cancer tissue, human stomach tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 8 publications below
IHC	See 1 publications below
IF	See 1 publications below

Product Information

13317-1-AP targets Cytoglobin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4161 Product name: Recombinant human CYGB protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-190 aa of BC029798 Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP Predict reactive species
Full Name	cytoglobin
Calculated Molecular Weight	190 aa, 21 kDa
Observed Molecular Weight	21-29 kDa
GenBank Accession Number	BC029798
Gene Symbol	Cytoglobin
Gene ID (NCBI)	114757
RRID	AB_2090645
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8WWM9
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytoglobin, also named as Histoglobin, HGb, STAP and CYGB, belongs to the globin family. Cytoglobin may have a protective function during conditions of oxidative stress. It may be involved in intracellular oxygen storage or transfer. It serves as a defensive mechanism against oxidative stress both in vitro and in vivo.(PMID:21224051) Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kd, runs as a 29kd one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.

Protocols

Product Specific Protocols
IHC protocol for Cytoglobin antibody 13317-1-AP	Download protocol
WB protocol for Cytoglobin antibody 13317-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
rat,mouse,human	WB,IF	Arterioscler Thromb Vasc Biol The Hemoglobin Homolog Cytoglobin in Smooth Muscle Inhibits Apoptosis and Regulates Vascular Remodeling. Authors - Frances L Jourd'heuil KD Validated View Article
human	WB	Antioxid Redox Signal The anti-oxidative role of cytoglobin in podocytes: implications for a role in chronic kidney disease. Authors - Elisa B Randi View Article
human	WB	Antioxidants (Basel) Cytoglobin Silencing Promotes Melanoma Malignancy but Sensitizes for Ferroptosis and Pyroptosis Therapy Response Authors - Joey De Backer KD Validated View Article
mouse	IHC	J Cell Physiol Integrative proteomics and immunochemistry analysis of the factors in the necrosis and repair in acetaminophen-induced acute liver injury in mice. Authors - Qin Feng View Article
human	WB	Mol Med Rep Intranasal administration of Cytoglobin modifies human umbilical cord‑derived mesenchymal stem cells and improves hypoxic‑ischemia brain damage in neonatal rats by modulating p38 MAPK signaling‑mediated apoptosis. Authors - Hanhua Yang View Article
human	WB	Vascul Pharmacol Endothelial cell-induced cytoglobin expression in vascular smooth muscle cells contributes to modulation of nitric oxide. Authors - Brenda Lilly View Article