CYP17A1 Polyclonal antibody

CYP17A1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 14447-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

17-alpha-hydroxyprogesterone aldolase, CPT7, CYP17, CYPXVII, Cytochrome P450 17A1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells, rat brain tissue, HeLa cells, HepG2 cells, mouse adrenal gland tissue, mouse brain tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14447-1-AP targets CYP17A1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5899

Product name: Recombinant human CYP17A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-508 aa of BC062997

Sequence: HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST

Predict reactive species
Full Name cytochrome P450, family 17, subfamily A, polypeptide 1
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 50-57 kDa
GenBank Accession NumberBC062997
Gene Symbol CYP17A1
Gene ID (NCBI) 1586
RRIDAB_2292527
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05093
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome P450 17A1 (CYP17A1) is a critical steroidogenic enzyme, essential for producing glucocorticoids and sex hormones (PMID: 33781841). The CYP17A1 gene is expressed in the adrenal cortex and the gonads but not in the placenta (PMID: 19403566). Although CYP17A1 has been shown to be a 50-kDa protein, the presence of a lower molecular mass(30 kDa) immunoreactive form in rat Leydig cells was previously shown and it is either a degradation product or a truncated form of the 50 kDa enzyme (PMID: 15761033). Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) and CYP17A1 is an important target for inhibition in the treatment of prostate cancer (PMID: 27505042).

Protocols

Product Specific Protocols
FC protocol for CYP17A1 antibody 14447-1-APDownload protocol
IF protocol for CYP17A1 antibody 14447-1-APDownload protocol
IHC protocol for CYP17A1 antibody 14447-1-APDownload protocol
WB protocol for CYP17A1 antibody 14447-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Part Fibre Toxicol

Chronic exposure to polystyrene microplastics induced male reproductive toxicity and decreased testosterone levels via the LH-mediated LHR/cAMP/PKA/StAR pathway.

Authors - Haibo Jin
pigWB

Biol Res

Unraveling the impact of hyperleptinemia on female reproduction: insights from transgenic pig model

Authors - Muhammad Ameen Jamal
humanIHC

J Clin Endocrinol Metab

PMID: 25137424

Authors - Kaisa Huhtinen
mouseIHC

J Cell Sci

Transgenic GATA-4 expression induces adrenocortical tumorigenesis in C57Bl/6 mice.

Authors - Chrusciel Marcin M
mouseIHC

FASEB J

Hydroxysteroid (17β)-dehydrogenase 1-deficient female mice present with normal puberty onset but are severely subfertile due to a defect in luteinization and progesterone production.

Authors - Janne Hakkarainen
mouseIF

Development

WNT signaling in pre-granulosa cells is required for ovarian folliculogenesis and female fertility.

Authors - Okiko Habara

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Hua (Verified Customer) (04-26-2024)

The size of the protein that the antibody recognizes in samples is much smaller than expected.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse liver and mouse brain
CYP17A1 Antibody Western Blot validation (1:1000 dilution) in mouse liver and mouse brain (Cat no:14447-1-AP)
FH

Tom (Verified Customer) (08-25-2021)

2 non-specific bands appear on membrane, but the correct band can be distinguished.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
CYP17A1 Antibody Western Blot validation (1:500 dilution) in (Cat no:14447-1-AP)
FH

Hailey (Verified Customer) (10-07-2019)

This antibody works very well for IF in mouse testis. We use Cyp17a1 as a marker for a lot of my experiments, and after comparing Cyp17a1 antibodies from many companies, this is our antibody of choice for IF. However for westerns, there is a pesky non-specific band that appears right below the correct band, and it is difficult to differentiate them unless you run the WB for a long time.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse testis
CYP17A1 Antibody Western Blot,Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Mouse testis (Cat no:14447-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...