Recombinant human DEXI protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag6869
Synonyms
MYLE
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
(1-95aa encoded by BC001083) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
