CRMP2 Polyclonal antibody

CRMP2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 14521-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

DPYSL2, CRMP-2, DHPRP2, Dihydropyrimidinase-related protein 2, DRP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse heart tissue, rat heart tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14521-1-AP targets CRMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5987

Product name: Recombinant human DPYSL2 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 224-572 aa of BC067109

Sequence: VLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Predict reactive species
Full Name dihydropyrimidinase-like 2
Calculated Molecular Weight 62 kDa
Observed Molecular Weight 62 kDa
GenBank Accession NumberBC067109
Gene Symbol CRMP2
Gene ID (NCBI) 1808
RRIDAB_2094341
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16555
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dihydropyrimidinase-like 2 (Dpysl2), a protein involved in neuronal differentiation and axonal guidance is found altered in various nervous system diseases (PMID:19524114). It is also named as CRMP2, ULIP2 and belongs to hydantoinase/dihydropyrimidinase subfamily. The phosphorylation of the particular portion carboxyl-terminal to the basic region of DPYSL2 may play an important role in regulating its activity, and may be involved in the formation of degenerating neurites in AD brain(PMID:10757975).

Protocols

Product Specific Protocols
IHC protocol for CRMP2 antibody 14521-1-APDownload protocol
WB protocol for CRMP2 antibody 14521-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

ACS Nano

Targeted Ganglion Delivery of CaV2.2-Mediated Peptide by DNA Nanoflowers for Relieving Myocardial Infarction and Neuropathic Pain

Authors - Jiaming Qiao
humanWB

Neural Regen Res

GIT1 enhances neurite outgrowth by stimulating microtubule assembly.

Authors - Yi-Sheng Li
ratWB

Ecotoxicol Environ Saf

Unraveling the role of abnormal AMPK and CRMP-2 phosphorylation in developmental fluoride neurotoxicity: Implications for synaptic damage and neurological disorders

Authors - Jingjing Zhang
Loading...
||
New chat Able
正在加载,请稍候...