Filter: AllWBIPIHCIF/ICC

WB analysis of HeLa using 10439-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 10439-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 10439-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 10439-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 10439-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 10439-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of K-562 using 10439-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of SKOV-3 using 10439-1-AP
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 10439-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of A549 using 10439-1-AP
A549 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IP experiment of HeLa using 10439-1-AP
IP result of anti-EIF3J (IP:10439-1-AP, 4ug; Detection:10439-1-AP 1:500) with HeLa cells lysate 880ug.
IHC staining of human breast cancer using 10439-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 10439-1-AP (EIF3J antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human breast cancer using 10439-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 10439-1-AP (EIF3J antibody) at dilution of 1:10 (under 10x lens).
IF Staining of HeLa using 10439-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EIF3J antibody (10439-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Featured Product
KD/KO Validated

EIF3J Polyclonal antibody

EIF3J Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10439-1-AP

Publications(4)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Eukaryotic translation initiation factor 3 subunit 1, EIF3S1, eIF-3-alpha, eIF3 p35, eIF3 alpha

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, A549 cells, HEK-293 cells, Jurkat cells, K-562 cells, MCF-7 cells, SKOV-3 cells
Positive IP detected in	HeLa cells
Positive IHC detected in	human breast cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 3 publications below
IF	See 2 publications below
IP	See 1 publications below

Product Information

10439-1-AP targets EIF3J in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0678 Product name: Recombinant human EIF3J protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC002719 Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM Predict reactive species
Full Name	eukaryotic translation initiation factor 3, subunit J
Calculated Molecular Weight	28 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC002719
Gene Symbol	EIF3J
Gene ID (NCBI)	8669
RRID	AB_2097082
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75822
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EIF3 has a key role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex(PMID:17588516). The eIF3 complex stimulates several steps in the translation initiation pathway, including dissociation of 80S ribosomes into 40S and 60S subunits, binding of a ternary complex (TC) consisting of Met-tRNA , eIF2, and GTP to the small subunit (forming the 43S preinitiation complex) and recruitment of mRNA to the 43 S complex to produce the 48S complex (PMID:11560931) EIF3J was identified as a high copy suppressor of the temperature-sensitive (Ts-) phenotype of the rpg1-1 allele of TIF32/RPG1, encoding the largest subunit of yeast eIF3 (eIF3a) (PMID:10488093).

Protocols

Product Specific Protocols
IF protocol for EIF3J antibody 10439-1-AP	Download protocol
IHC protocol for EIF3J antibody 10439-1-AP	Download protocol
IP protocol for EIF3J antibody 10439-1-AP	Download protocol
WB protocol for EIF3J antibody 10439-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB,IF,IP	J Cell Biol eIF4GI links nutrient sensing by mTOR to cell proliferation and inhibition of autophagy. Authors - Ramírez-Valle Francisco F KD Validated View Article
human	IF	Cell Death Dis Nitric oxide triggers the assembly of "type II" stress granules linked to decreased cell viability. Authors - Anaïs Aulas View Article
human	WB	bioRxiv PARP10 is Critical for Stress Granule Initiation Authors - Aravinth Kumar Jayabalan View Article
pig	WB	J Virol VP3 protein of Senecavirus A promotes viral IRES-driven translation and attenuates innate immunity by specifically relocalizing hnRNPA2B1 Authors - Lu Li View Article