Home
Products
Primary Antibodies
Endoglin/CD105 Polyclonal antibody (10862-1-AP)

Featured Product
KD/KO Validated

Endoglin/CD105 Polyclonal antibody

Endoglin/CD105 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 10862-1-AP

Publications(69)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

CD105, END, Endoglin, ENG, HHT1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF-P

WB analysis using 10862-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 10862-1-AP
WB result of Endoglin/CD105 antibody (10862-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Endoglin/CD105 transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10862-1-AP
human placenta tissue was subjected to SDS PAGE followed by western blot with 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse lung using 10862-1-AP
IP result of anti-Endoglin/CD105 (IP:10862-1-AP, 4ug; Detection:10862-1-AP 1:2000) with mouse lung tissue lysate 1760 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:4000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:4000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 10862-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10862-1-AP (Endoglin/CD105 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human placenta using 10862-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Endoglin/CD105 antibody (10862-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (69)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HUVEC cells, HeLa cells, human placenta tissue, mouse lung tissue, rat lung tissue
Positive IP detected in	mouse lung tissue
Positive IHC detected in	human breast cancer tissue, human liver cancer tissue, human lung cancer tissue, human placenta tissue, rat kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human placenta tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10862-1-AP targets Endoglin/CD105 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, bovine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1287 Product name: Recombinant human Endoglin/CD105 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 331-658 aa of BC014271 Sequence: GGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA Predict reactive species
Full Name	endoglin
Calculated Molecular Weight	71 kDa
Observed Molecular Weight	75-90 kDa, 170-180 kDa
GenBank Accession Number	BC014271
Gene Symbol	CD105
Gene ID (NCBI)	2022
RRID	AB_2098906
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P17813
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 90-95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)

Protocols

Product Specific Protocols
IF protocol for Endoglin/CD105 antibody 10862-1-AP	Download protocol
IHC protocol for Endoglin/CD105 antibody 10862-1-AP	Download protocol
IP protocol for Endoglin/CD105 antibody 10862-1-AP	Download protocol
WB protocol for Endoglin/CD105 antibody 10862-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	IF	Cell Early rhombic lip Protogenin+ve stem cells in a human-specific neurovascular niche initiate and maintain group 3 medulloblastoma Authors - Abhirami Visvanathan View Article
mouse	IF	Exploration (Beijing) PSMA-Targeting Macrophage Membrane-Coated Nanoparticles for Precision Diagnosis and Combination Therapy of Prostate Cancer. Authors - Keying Zhang View Article
rat	IF	Bioact Mater Spatiotemporally programming the immune-osteogenic cascade with a dual-immunomodulatory scaffold for functional bone regeneration. Authors - Hongyu Zhao View Article
mouse	IF	Bioact Mater Adipose-derived mesenchymal stem cells (MSCs) are a superior cell source for bone tissue engineering Authors - Yannian Gou View Article
human	IP	Drug Resist Updat CD105 blockade restores osimertinib sensitivity in drug-resistant EGFR-mutant non-small cell lung cancer Authors - Manish Thiruvalluvan View Article
human	WB,IP,IF	J Extracell Vesicles CD133 Shapes Extracellular Vesicle Cargo and Angiogenic Function in Basal-Like Triple-Negative Breast Cancer. Authors - Mireia Gomez-Duro View Article