Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ERC1 Polyclonal antibody

ERC1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

ELKS, Cast2, ELKS/Rab6-interacting/CAST family member 1, ERC 1, ERC-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ERC1 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, Jurkat cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22211-1-AP targets ERC1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17536

Product name: Recombinant human ERC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 985-1116 aa of BC132782

Sequence: DNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS

Predict reactive species
Full Name ELKS/RAB6-interacting/CAST family member 1
Calculated Molecular Weight 1116 aa, 128 kDa
Observed Molecular Weight 124-135 kDa
GenBank Accession NumberBC132782
Gene Symbol ERC1
Gene ID (NCBI) 23085
RRIDAB_11232409
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IUD2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ERC is an acronym based on previous separate namings of members of this protein family, ELKS, Rab6IP2 and CAST (PMID: 12391317). They are known to bind RIMs, the active zone proteins that regulate neurotransmitter release. ERC1 (ELKS) is an essential regulatory subunit of the IKK complex and likely functions by recruiting IκBα to the complex (PMID: 15218148). Multiple isoforms of ERC1 mRNA are generated by alternative splicing (PMID: 12203787). There are two known splice variants of ERC1 protein that differ at their C termini, ERC1a and ERC1b. ERC1a is ubiquitously expressed, whereas ERC1b is brain-specific (PMID: 12391317; 12923177).

Protocols

Product Specific Protocols
IF protocol for ERC1 antibody 22211-1-APDownload protocol
IHC protocol for ERC1 antibody 22211-1-APDownload protocol
WB protocol for ERC1 antibody 22211-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ERC1 Polyclonal antibody (Cat# 22211-1-AP) has 7 total citations published in Nature Communications, Translational Psychiatry, Journal of Cell Biology (×2), Scientific Reports, Journal of Biological Chemistry, and Journal of Cell Science. Research fields span microtubule dynamics and protein condensates, neurodevelopmental disorders (schizophrenia), Golgi export and mechanical signaling, protein secretion at focal adhesions, cross-linking mass spectrometry, cytokinesis regulation, and insulin secretion in β-cells.

SpeciesApplicationTitle
ratWB,IF

Nat Commun

CLASP-mediated competitive binding in protein condensates directs microtubule growth

Authors - Xuanyan Jia
mouseWB

Transl Psychiatry

G6PD deficiency in brain induces schizophrenia-like behaviors and synaptic dysfunction.

Authors - Yu-Bing Wang
humanIF

J Cell Biol

RAB6 and microtubules restrict protein secretion to focal adhesions.

Authors - Lou Fourriere

J Cell Biol

Mechanical forces stimulate Golgi export.

Authors - Chandini Bhaskar Naidu
WB

Sci Rep

Facilitating identification of minimal protein binding domains by cross-linking mass spectrometry.

Authors - Qingyang Liu
humanWB

J Biol Chem

MICAL3 flavoprotein monooxygenase forms a complex with centralspindlin and regulates cytokinesis.

Authors - Qingyang Liu
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer review is available for this product. The reviewer rated it 5 out of 5 stars and reported successful use in Immunofluorescence on HUVEC cells at a 1:200 dilution, noting that the antibody performed well. Overall, the feedback is positive, confirming reliable performance in IF applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sammy (Verified Customer) (11-20-2023)

Ab performs well by Immunofluorescence.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1 in 200 IF
  • Cell Tissue Type: HUVEC
Loading...
||
New chat

Able™

正在加载,请稍候...