FECH Fusion Protein

Catalog number: Ag5814
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Powder

Please visit your regions distributor:


You can also
Request A Quote

Images See all

FECH fusion protein Ag5814 SDS-PAGE


Product Name:
human FECH-GST fusion protein

Catalog No:
Ag5814

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
VQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
(60 - 423 aa encoded by BC039841)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Purity:
60%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Back
to top