Tested Applications
Positive WB detected in | mouse brain tissue, Jurkat cells, rat brain tissue |
Positive IHC detected in | human normal colon, human colon tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 7 publications below |
IHC | See 1 publications below |
Product Information
10273-1-AP targets FKBP1A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0406 Product name: Recombinant human FKBP1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-108 aa of BC001925 Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Predict reactive species |
Full Name | FK506 binding protein 1A, 12kDa |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC001925 |
Gene Symbol | FKBP1A |
Gene ID (NCBI) | 2280 |
RRID | AB_2231588 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62942 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for FKBP1A antibody 10273-1-AP | Download protocol |
WB protocol for FKBP1A antibody 10273-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep Sequencing of captive target transcripts identifies the network of regulated genes and functions of primate-specific miR-522. | ||
Food Chem TMT-based quantitative proteomic analysis of porcine muscle associated with postmortem meat quality. | ||
Cell Biol Toxicol Andrographolide ameliorates sepsis-induced acute liver injury by attenuating endoplasmic reticulum stress through the FKBP1A-mediated NOTCH1/AK2 pathway | ||
Oncotarget TGFBR-IDH1-Cav1 axis promotes TGF-β signalling in cancer-associated fibroblast. | ||
Mol Pharmacol FK506 Binding Protein 12 Modulates μ Opioid Receptor Phosphorylation and PKC{epsilon}-dependent Signaling by its Direct Interaction with the Receptor.
| ||
Development PFN4 is required for manchette development and acrosome biogenesis during mouse spermiogenesis |