Tested Applications
| Positive WB detected in | C6 cells, HEK-293 cells, human brain tissue, Neuro-2a cells, Jurkat cells, MCF-7 cells, HeLa cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human colorectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | sodium arsenite treated HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13057-2-AP targets G3BP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, drosophila melanogaster (fruit fly) |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3728 Product name: Recombinant human G3BP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 167-466 aa of BC006997 Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ Predict reactive species |
| Full Name | GTPase activating protein (SH3 domain) binding protein 1 |
| Calculated Molecular Weight | 466 aa, 52 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC006997 |
| Gene Symbol | G3BP1 |
| Gene ID (NCBI) | 10146 |
| RRID | AB_2232034 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13283 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for G3BP1 antibody 13057-2-AP | Download protocol |
| WB protocol for G3BP1 antibody 13057-2-AP | Download protocol |
| FC protocol for G3BP1 antibody 13057-2-AP | Download protocol |
| IF protocol for G3BP1 antibody 13057-2-AP | Download protocol |
| IHC protocol for G3BP1 antibody 13057-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-G3BP1 antibody (Cat# 13057-2-AP) has accumulated 296 citations across high-impact journals including Nature, Science, Cell, Nature Communications, Neuron, Molecular Cell, Nature Cell Biology, Brain, EMBO Reports, and Cell Reports. Research fields span stress granule biology and liquid-liquid phase separation, neurodegenerative diseases (ALS, FTD, Parkinson's), viral infections (SARS-CoV-2 and others), cancer biology, innate immunity, RNA metabolism, protein homeostasis, and metabolic disorders such as diabetes and liver disease.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Phase-separated nucleocapsid protein of SARS-CoV-2 suppresses cGAS-DNA recognition by disrupting cGAS-G3BP1 complex | ||
Signal Transduct Target Ther SARS-CoV-2 NSP5 and N protein counteract the RIG-I signaling pathway by suppressing the formation of stress granules. | ||
Science Ubiquitination of G3BP1 mediates stress granule disassembly in a context-specific manner. |
Reviews
What customers say
All 21 reviews are 5-star. Users consistently report strong, specific signal across Western Blot (typically 1:1000), immunofluorescence (1:100–1:500), immunoprecipitation, and flow cytometry. It excels at labeling stress granules induced by sodium arsenite in HeLa, HCT116, PANC1, and neuronal cells. One user noted the antibody can be reused up to 3 times. Multiple reviewers called it the best G3BP1 antibody they have used, with one lab relying on it for years across IP, WB, and IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vasudevarao (Verified Customer) (04-09-2026) | Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines.
|
Prakash (Verified Customer) (10-17-2025) | working very well in western blot
|
lu (Verified Customer) (09-18-2025) | Good antibody for flow cytometry
|
Nikolett (Verified Customer) (07-29-2025) | Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines.
|
Xiaochen (Verified Customer) (11-11-2024) |
![]() |
Xiaochen (Verified Customer) (11-11-2024) |
![]() |
Roy (Verified Customer) (06-12-2024) | Works great on WB (1/1000 - Overnight 4°C) - Very beautiful IF staining in non stressed (diffuse staining) and Sodium Arsenite-mediated Stress induction (Punctate staining corresponding to stress granules) in HeLa cells (1/250 - 1h at RT).
|
Vinny (Verified Customer) (02-20-2024) | Good product.
|
Andrea (Verified Customer) (10-05-2023) | Good and strong signal.
|
Tatyana (Verified Customer) (01-21-2023) | Used for IP and WB of GFP-tagged overexpressed human G3BP1 (HEK293 cells). Lysates were subjected to IP using GFP-Trap beads. WB was done using semi-dry transfer. Antibody was used in 4% milk in TBST at 1:1,000 dilution. It could be reused up to 3 times. As the image shows, the antibody can successfully detect both endogenous and OE protein.
![]() |
Tobias (Verified Customer) (10-25-2022) |
|
Peter (Verified Customer) (10-24-2022) | Best G3BP1 antibody I've used for Western, IF and IP
|
Patryk (Verified Customer) (03-18-2021) | I used the antibody for immunofluorescence imaging to label stress granules induced by treating the cells with with 50µM sodium arsenite. Used the antibody at a dilution 1:100 overnight at 4°C. Worked perfectly well, strong and specific signal. I am very satisfied of this antibody and strongly recommend if for immunofluorescence.
![]() |
Kun (Verified Customer) (03-23-2020) | Very specific and sensitive
|
Biao (Verified Customer) (03-11-2020) | This antibody is very specific and good quality.
|
Joshua (Verified Customer) (12-28-2019) | PANC1 cells fixed in 4% paraformaldehdye. Bright localization to stress granules.
![]() |
Yuan (Verified Customer) (11-02-2019) | Very bright staining for stress granule on NaAsO2 treated Hela cells. 1:500 should be sufficient for IF staining.
![]() |
Zeinab (Verified Customer) (08-19-2019) | It worked great
|
Erica (Verified Customer) (05-15-2019) | Our lab has been using this antibody for IP, WB and IF for many years and it always worked well. I highly recommend this antibody, especially for IP for stress granules.
|
Karthik (Verified Customer) (04-24-2019) | Upon induction of sodium arsenite stress in neurons G3BP1 positive stress granules formed in 90 minutes.Cells permeabilized with 0.2% triton for 10 minutes
![]() |
Tian (Verified Customer) (01-23-2019) | I used it for ICC and it worked Great.
|








































