Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11994-1-AP targets Glutamate receptor 2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2662 Product name: Recombinant human GRIA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 36-356 aa of BC010574 Sequence: GADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLVEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGL Predict reactive species |
| Full Name | glutamate receptor, ionotropic, AMPA 2 |
| Calculated Molecular Weight | 883 aa, 99 kDa |
| Observed Molecular Weight | 94-105 kDa |
| GenBank Accession Number | BC010574 |
| Gene Symbol | GRIA2 |
| Gene ID (NCBI) | 2891 |
| RRID | AB_2113725 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42262 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA2 (glutamate receptor 2, GluR-2) belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels that mediate the fast component of excitatory postsynaptic currents in neurons of the central nervous system. These channels are assembled from 4 related subunits, GRIA1-4. The presence of GRIA2 in the heteromeric AMPA receptors impermeabilizes it to calcium, preventing possible calcium-mediated toxicity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
| IHC protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
| IP protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
| WB protocol for Glutamate receptor 2 antibody 11994-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Glutamate receptor 2 Polyclonal antibody (Cat# 11994-1-AP) has 68 citations across journals including Nature, Nature Biotechnology, Science Advances, Cell Discovery, Journal of Clinical Investigation, Molecular Psychiatry, Cell Death & Disease, Journal of Neuroscience, and eLife. Research fields span neuroscience, epilepsy, Alzheimer's disease, autism spectrum disorder, depression, synaptic plasticity, AMPA/NMDA receptor biology, neuroinflammation, cognitive dysfunction, pain, and stroke. Applications are predominantly Western blot, with immunofluorescence, IHC, IP, and CoIP also represented.
| Species | Application | Title |
|---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
ACS Nano Small Molecule Hydrogels Loading Small Molecule Drugs from Chinese Medicine for the Enhanced Treatment of Traumatic Brain Injury | ||
Cell Discov Postsynaptic lncRNA Sera/Pkm2 pathway orchestrates the transition from social competition to rank by remodeling the neural ensemble in mPFC | ||
Genes Dis The Traf2 and NcK interacting kinase inhibitor NCB-0846 suppresses seizure activity involving the decrease of GRIA1 | ||
J Clin Invest TMEM25 modulates neuronal excitability and NMDA receptor subunit NR2B degradation. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot and reported positive results. One user confirmed it works well at a 1:5000 dilution on cerebellum lysates. Another user, testing on hiPSCs-derived neurons at 1:1000, noted a strong signal with clean bands (50–70 seconds exposure) but cautioned that the diluted antibody (TBS 0.1% Tween + 5% BSA) loses performance after 2–3 reuses. Overall, the antibody is rated highly for WB applications with good specificity and signal strength.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrea (Verified Customer) (08-05-2026) | It works properly by WB on cerebellum lysates
|
Lisa (Verified Customer) (10-04-2021) | The antibody signal is quite strong (50-70sec of exposure) and gives "clean" bands. The diluted antibody (TBS 0.1% Tween+5% BSA) does not work well anymore after 2-3 times of re-use
|
