Use Able AI chat for product recommendations

LCOR Polyclonal antibody

LCOR Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

MLR2, Mblk1-related protein 2, Ligand-dependent corepressor, C10orf12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LCOR in ?

Tested Applications

Positive WB detected inHeLa cells
Positive IHC detected inhuman endometrial cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14476-1-AP targets LCOR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5851

Product name: Recombinant human LCOR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-406 aa of BC053359

Sequence: MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQSRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMSG

Predict reactive species
Full Name ligand dependent nuclear receptor corepressor
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC053359
Gene Symbol LCOR
Gene ID (NCBI) 84458
RRIDAB_2136862
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96JN0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box [PMID:12535528]. It functions through recruitment of C-terminal binding proteins (CtBPs) and histone deacetylases (HDACs) to its N-terminal and central domains, respectively [PMID:22277651]. It is a scaffold for both histone deacetylases (HDACs) and C-terminal binding protein (CtBP) corepressors and functions by both HDAC-dependent and -independent mechanisms in a receptor-specific manner[PMID:19744932].

Protocols

Product Specific Protocols
IF protocol for LCOR antibody 14476-1-APDownload protocol
IHC protocol for LCOR antibody 14476-1-APDownload protocol
WB protocol for LCOR antibody 14476-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The LCOR Polyclonal antibody (Cat# 14476-1-AP) has 2 citations. One appears in Ecotoxicology and Environmental Safety, studying m6A methylation-mediated lipid accumulation in rat fetal anorectal malformations via miR-205/LCOR signaling. The other is in BMC Biotechnology, investigating LCOR's role in suppressing angiogenesis and macrophage infiltration in glioblastoma microenvironment through MCP-1 down-regulation. The associated research fields include ecotoxicology, developmental biology, RNA modification, neuro-oncology, and tumor microenvironment immunology.

SpeciesApplicationTitle

Ecotoxicol Environ Saf

m6A-methylated TAL1 exacerbates lipid accumulation in ethylene bisdithiocarbamate metabolite-induced anorectal malformations in rat fetuses via miR-205/LCOR signaling

Authors - Yifan Yao

BMC Biotechnol

Ligand-dependent corepressor suppresses angiogenesis and macrophage infiltration in gliobl astoma microenvironment via MCP-1 down-regulation.

Authors - Shu-Kai Lin
Loading...
||
New chat

Able™

正在加载,请稍候...