Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive IF/ICC detected in | hiPSC |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10458-1-AP targets MBP in WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0713 Product name: Recombinant human MBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC008749 Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR Predict reactive species |
| Full Name | myelin basic protein |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 14-23 kDa |
| GenBank Accession Number | BC008749 |
| Gene Symbol | Myelin basic protein |
| Gene ID (NCBI) | 4155 |
| RRID | AB_2250289 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02686 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MBP belongs to the myelin basic protein family. The classic group of MBP isoforms (isoform 4-isoform 14) are the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. MBP has six isoforms. Catalog#10458-1-AP is capable of recognizing multiple isoforms of MBP.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MBP antibody 10458-1-AP | Download protocol |
| IHC protocol for MBP antibody 10458-1-AP | Download protocol |
| WB protocol for MBP antibody 10458-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
ACS Nano Neutrophil Nanovesicle Protects against Experimental Autoimmune Encephalomyelitis through Enhancing Myelin Clearance by Microglia | ||
ACS Nano Supramolecular Hydrogel Microspheres of Platelet-Derived Growth Factor Mimetic Peptide Promote Recovery from Spinal Cord Injury | ||
Nat Commun Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model | ||
Neuron A gain-of-function Retsat variant from high-altitude adaptation promotes myelination via a neuronal dihydroretinoic acid-RXR-γ pathway | ||
Microbiome The microbiota-gut-brain axis participates in chronic cerebral hypoperfusion by disrupting the metabolism of short-chain fatty acids. | ||
Plant Commun Hydroxylation of HPPD facilitates its PUB11-mediated ubiquitination and degradation in response to oxidative stress in Arabidopsis |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Samantha (Verified Customer) (08-29-2025) | Used in a Western Blot and detected myelin in human dorsal root ganglia and bound to recombinant myelin protein
|
Kenzo (Verified Customer) (08-16-2023) | This MBP antibody worked well and generated robust immunofluorescence signals on mouse optic nerve sections.
|
Rebecca (Verified Customer) (02-10-2022) | Western performed on Biorad MiniPROTEAN 4-15% TGX precast gels and Precision Plus All Blue Protein Ladder and 4x Laemmli Sample Buffer. Blocking performed for 1h at room temperature using 5%BLOTTO. Primary antibody dilution was performed overnight at 4°C in 5%BLOTTO/0.05%Tween. Secondary antibody was LiCOR IRDye® 680RD Donkey anti-Mouse IgG (H + L) at 1:20000 dilution in PBS-Tween-SDS as per manufacturers instructions for 2h at room temperature. Blot showed clear bands of the expected isoform sizes with very low-none background/off target binding.
 |
