CoraLite® Plus 488-conjugated MBP Polyclonal antibody

MBP Polyclonal Antibody for IF-P
Cat No. CL488-10458

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

myelin basic protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10458 targets MBP in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0713

Product name: Recombinant human MBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC008749

Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

Predict reactive species
Full Name myelin basic protein
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 14-23 kDa
GenBank Accession NumberBC008749
Gene Symbol Myelin basic protein
Gene ID (NCBI) 4155
RRIDAB_3083878
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02686
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MBP belongs to the myelin basic protein family. The classic group of MBP isoforms (isoform 4-isoform 14) are the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. MBP has six isoforms. Catalog#10458-1-AP is capable of recognizing multiple isoforms of MBP.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MBP antibody CL488-10458Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...