Product Information
12692-1-AP targets MBTPS2 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3404 Product name: Recombinant human MBTPS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 229-330 aa of BC036465 Sequence: VLALLGILALVLLPVILLPFYYTGVGVLITEVAEDSPAIGPRGLFVGDLVTHLQDCPVTNVQDWNECLDTIAYEPQIGYCISASTLQQLSFPVRGVYISSI Predict reactive species |
Full Name | membrane-bound transcription factor peptidase, site 2 |
Calculated Molecular Weight | 36 kDa, 57 kDa |
GenBank Accession Number | BC036465 |
Gene Symbol | MBTPS2 |
Gene ID (NCBI) | 51360 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43462 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |